mirror of
https://gitlab.gnome.org/GNOME/gimp
synced 2024-10-22 12:32:37 +00:00
cfe5e88fc9
* plug-ins/gfig/gfig-dialog.c * plug-ins/gfig/gfig-dialog.h plug-ins/gfig/gfig-dobject.c: renamed undo_water_mark to undo_level. Fixed the style handling when clearing the whole thing and undoing in some very particular cases. The undo part should certainly be redone to some extent. Btw, this is the revision 1.10000 of the ChangeLog, yeah!
20323 lines
656 KiB
Plaintext
20323 lines
656 KiB
Plaintext
2004-11-28 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-dialog.h
|
||
plug-ins/gfig/gfig-dobject.c: renamed undo_water_mark to undo_level.
|
||
Fixed the style handling when clearing the whole thing and undoing in
|
||
some very particular cases. The undo part should certainly be redone
|
||
to some extent.
|
||
|
||
Btw, this is the revision 1.10000 of the ChangeLog, yeah!
|
||
|
||
2004-11-28 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/gfig/gfig-style.c: make sure PaintType is saved and
|
||
loaded with the style.
|
||
|
||
2004-11-28 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c: correctly initializes the paint_type
|
||
field of the default style.
|
||
|
||
* plug-ins/gfig/gfig-style.c: don't print an useless error message
|
||
where no-one can see it when loading an other with no style but use
|
||
the default style instead.
|
||
|
||
2004-11-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.[ch]
|
||
* plug-ins/gfig/gfig-dobject.c: moved Undo and Clear to the Edit
|
||
menu. Added a utility function to set the sensitivity of an action
|
||
by name. Cleaned up action callback.
|
||
|
||
* plug-ins/gfig/gfig-style.c: minor cleanup.
|
||
|
||
2004-11-28 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-arc.c
|
||
* plug-ins/gfig/gfig-bezier.c
|
||
* plug-ins/gfig/gfig-circle.c
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-ellipse.c
|
||
* plug-ins/gfig/gfig-line.c
|
||
* plug-ins/gfig/gfig-poly.c
|
||
* plug-ins/gfig/gfig-spiral.c
|
||
* plug-ins/gfig/gfig-star.c: made the class name uppercase since it is
|
||
used to parse a gfig file.
|
||
|
||
2004-11-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c: make sure that widgets in the Grid
|
||
and Preferences dialogs are only accessed while the dialogs exist.
|
||
|
||
2004-11-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c: made the Grid and Preferences
|
||
dialogs singletons and declared them as transient to the GFig
|
||
window. Don't let them run their own main loop.
|
||
|
||
2004-11-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c: added a Close menu item to the
|
||
menubar. Removed help buttons from popup dialogs. Set the same
|
||
default directory in load and save filechoosers.
|
||
|
||
2004-11-27 Manish Singh <yosh@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/drawable_transform.pdb: escape utf8 as hex, to
|
||
avoid perl trying to be so smart that it's stupid.
|
||
|
||
* app/pdb/drawable_transform_cmds.c: regenerated.
|
||
|
||
2004-11-27 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/common/jpeg.c (save_image): thumbnail buffer variable
|
||
declarations should be guarded under HAVE_EXIF.
|
||
|
||
2004-11-27 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/pygimp/plug-ins/colorxhtml.py: s/colorhtml/colorxhtml/,
|
||
so it doesn't clash with the perl version.
|
||
|
||
* plug-ins/pygimp/plug-ins/Makefile.am: reflect filename change.
|
||
|
||
2004-11-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/jpeg.c: delay the creation of the display for
|
||
the export image preview until the user requests a preview. Fixes
|
||
bug #159376.
|
||
|
||
2004-11-27 Øyvind Kolås <pippin@gimp.org>
|
||
|
||
* libgimp/gimpexport.c: minor layout adjustments for HIG compliance.
|
||
|
||
2004-11-27 Kevin Cozens <kcozens@cvs.gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/spyrogimp.scm: Force number of teeth
|
||
to be integer values. Changed default for Outer teeth to give a
|
||
more interesting image. Detabified file. Fixes bug #158448.
|
||
|
||
2004-11-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-scripts.c (script_fu_script_proc):
|
||
don't look at the menu path to determine if the script is
|
||
image-based. Instead look at the number of parameters we are being
|
||
called with.
|
||
|
||
2004-11-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimpinkoptions-gui.c: made the Size scale logarithmic
|
||
as suggested in bug #159632.
|
||
|
||
2004-11-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/tiff.c (save_image): tell the user that we can't
|
||
handle indexed images with alpha channel (bug #159600).
|
||
|
||
2004-11-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/main.c
|
||
* app/widgets/gimpenumstore.h
|
||
* app/widgets/gimpunitstore.c
|
||
* plug-ins/common/retinex.c: applied patch by Tim Mooney that
|
||
removes extraneous ;
|
||
|
||
2004-11-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/wmf.c (run): applied patch by Tim Mooney that
|
||
increase the size of values[] to accomodate the use of
|
||
file_wmf_load_thumb (bug #159601).
|
||
|
||
2004-11-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/drawable.pdb: minor change to the PDB docs.
|
||
|
||
* libgimp/gimpdrawable_pdb.c
|
||
* tools/pdbgen/pdb/drawable.pdb: regenerated.
|
||
|
||
2004-11-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/winicon/icosave.c
|
||
* plug-ins/winicon/main.[ch]: moved code around.
|
||
|
||
2004-11-26 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/common/dog.c: make sure the preview image type matches
|
||
the source image type.
|
||
|
||
2004-11-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/winicon/icosave.c: don't fiddle with the source image,
|
||
a save plug-in should save, nothing else.
|
||
|
||
* plug-ins/winicon/main.[ch]: handle all sorts of image types.
|
||
Fixes bug #157803.
|
||
|
||
2004-11-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/drawable.pdb: fixed docs for
|
||
gimp_drawable_type_with_alpha().
|
||
|
||
* app/pdb/drawable_cmds.c
|
||
* libgimp/gimpdrawable_pdb.c: regenerated.
|
||
|
||
2004-11-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/winicon/main.[ch] (ico_image_get_reduced_buf)
|
||
* plug-ins/winicon/icodialog.c
|
||
* plug-ins/winicon/icoload.c
|
||
* plug-ins/winicon/icosave.c: fixed drawable handling. This
|
||
plug-in is still a complete mess and needs a lot more work.
|
||
|
||
2004-11-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimppaintoptions-gui.c (gimp_paint_options_gui): only
|
||
show the Incremental toggle for tools that use it (bug #159306).
|
||
|
||
2004-11-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpdocumentlist.c (gimp_document_list_deserialize):
|
||
don't add documents w/o a name to the list. Fixes bug #159510.
|
||
|
||
* app/core/gimpdrawable.c (gimp_drawable_resize): extended the
|
||
check to take the offsets into account as well.
|
||
|
||
2004-11-25 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/common/dog.c: Add the temporary layers to the image, so
|
||
things work. Fixes bug #158895.
|
||
|
||
* plug-ins/common/iwarp.c: Fix same naughtiness as above. There's
|
||
other naughtiness still though.
|
||
|
||
* plug-ins/common/sunras.c: use gboolean for byte2bit invert argument.
|
||
|
||
2004-11-25 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/common/jpeg.c: Use a jpeg_error_mgr that lives within
|
||
PreviewPersistent, instead of an automatic variable in save_image.
|
||
Fixes bug #159076.
|
||
|
||
2004-11-25 Simon Budig <simon@gimp.org>
|
||
|
||
* modules/controller_linux_input.c: Add some sample code to retrieve
|
||
the name of the connected MIDI device (ALSA).
|
||
Do not set the "name" when connected to Alsa, since snd_seq_name()
|
||
returns an uninteresting name.
|
||
|
||
2004-11-24 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/gui/gui.c (gui_display_changed): if the active display
|
||
becomes NULL (e.g. by closing a view), don't leave the user
|
||
context with an image but no display. Instead, try to find another
|
||
display of the same image and if that fails set the image to NULL.
|
||
|
||
Prevents the various foo_actions_update() functions from being
|
||
called with a NULL display while there is still an active image in
|
||
the context.
|
||
|
||
Fixes bug #159304.
|
||
|
||
(Removed #warning about being misplaced from that function because
|
||
it's a typical piece of ugly glue code that belongs exactly here).
|
||
|
||
2004-11-24 Simon Budig <simon@gimp.org>
|
||
|
||
* modules/controller_linux_input.c: Accept >= 0 return values of the
|
||
ioctl() to figure out the device name. Apparently it is the number of
|
||
bytes written to the string, so we might omit the strlen() following,
|
||
but I don't like to rely on that...
|
||
|
||
2004-11-24 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcontroller.[ch]: guarded the whole header
|
||
with GIMP_ENABLE_CONTROLLER_UNDER_CONSTRUCTION because it's no
|
||
fixed API yet. Added a "state" property bacause "name" was abused
|
||
as the controller's state. Added "help_domain" to the controller
|
||
class.
|
||
|
||
* libgimpwidgets/gimpwidgets.h: don't include gimpcontroller.h
|
||
|
||
* modules/controller_linux_input.c
|
||
* modules/controller_midi.c: set the "name" property to the name
|
||
retrieved from the device, or to a default string if no name is
|
||
available. Store the status in the "state" property. Added and
|
||
changed some strings, but it's better to have the controller
|
||
strings untranslated than to have no tooltips at all or misleading
|
||
labels.
|
||
|
||
* app/widgets/gimpcontrollerkeyboard.c
|
||
* app/widgets/gimpcontrollerwheel.c: set default strings for both.
|
||
|
||
* app/widgets/gimpcontrollereditor.c: added a GUI for the "state"
|
||
property.
|
||
|
||
* app/widgets/gimpcontrollerkeyboard.h
|
||
* app/widgets/gimpcontrollerwheel.h
|
||
* app/widgets/gimpcontrollerinfo.c
|
||
* app/widgets/gimpcontrollers.c: #define
|
||
GIMP_ENABLE_CONTROLLER_UNDER_CONSTRUCTION (just as in all files
|
||
above).
|
||
|
||
* app/widgets/gimphelp-ids.h: added the IDs of all controller
|
||
modules and also of all other modules. The defines are not
|
||
actually used, but this file is the canonical place to collect all
|
||
the core's help IDs.
|
||
|
||
2004-11-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimp-templates.[ch]
|
||
* app/dialogs/user-install-dialog.c: merge the migrated user
|
||
templaterc with the system templaterc so the users who have used
|
||
gimp-2.0 before get our changes to the default templates.
|
||
|
||
2004-11-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpwidgets-utils.[ch]: added new function
|
||
gimp_toggle_button_set_visible() which can be used as "toggled"
|
||
callback on a GtkToggleButton and sets a widget (in)visible
|
||
according to the toggle's "active" state.
|
||
|
||
* app/tools/gimpblendoptions.c
|
||
* app/tools/gimppaintoptions-gui.c
|
||
* app/tools/gimpselectionoptions.c: use it to hide (rather than
|
||
just insensitize) the seldomly used "Feather edges", "Autoshrink
|
||
selection", "Adaptive supersampling", "Fade out" and "Use color
|
||
from gradient" widgets when their enabling toggle is unchecked.
|
||
Makes the affected tool options much less crowded and noisy in
|
||
their default appearance. Fixes bug #159008.
|
||
|
||
2004-11-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/menus/plug-in-menus.c (plug_in_menus_add_proc): create
|
||
dynamic sub-menus using a separate, ui-manager-global merge_id
|
||
instead of the procedure's merge_id. Has the effect that the ui
|
||
manager keeps around these sub-menus forever, even if the
|
||
procedure that initially registered them is unregistered.
|
||
Fixes menu ordering after Script-Fu->Refresh.
|
||
|
||
2004-11-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpparasitelist.c: cosmetics, untabified.
|
||
|
||
* libgimpbase/gimpparasiteio.[ch]: added g_return_if_fail()'s
|
||
to all functions.
|
||
|
||
(gimp_pixpipe_params_parse): changed "gchar*" param to "const
|
||
gchar*" (sortof API change, but these files are most probably only
|
||
used by GIMP itself). Still uses strtok() on the internal copy,
|
||
but at least not on the passed string.
|
||
|
||
* plug-ins/common/csource.c
|
||
* plug-ins/common/gif.c
|
||
* plug-ins/common/gih.c
|
||
* plug-ins/common/jpeg.c
|
||
* plug-ins/common/png.c
|
||
* plug-ins/common/tiff.c: use parasite getters instead of
|
||
accessing the scruct members directly. Always use g_strndup()
|
||
instead of just g_strdup() to get strings stored in parasites
|
||
because there is no guarantee that they are nul-terminated.
|
||
|
||
2004-11-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/imagemap/imap_file.c (do_file_save_as_dialog): do
|
||
actually use a save dialog here. Fixes bug #159194.
|
||
|
||
2004-11-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpdrawable.c (gimp_drawable_resize): do nothing if
|
||
the size doesn't change. This keeps text layers from being
|
||
modified when an image is cropped and the layer is entirely inside
|
||
the cropped area.
|
||
|
||
* menus/image-menu.xml.in: put the Quit item back for now. We
|
||
should think about this again in the next development cycle.
|
||
|
||
2004-11-22 Kevin Cozens <kcozens@cvs.gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/copy-visible.scm: Fixed incorrect
|
||
comparison in if statement. Partial(?) fix for bug #138662.
|
||
|
||
2004-11-22 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/pygimp/Makefile.am
|
||
* plug-ins/pygimp/pygimp-logo.png: New pygimp logo, by Carol Spears.
|
||
|
||
* plug-ins/pygimp/gimpfu.py: Use new external logo file, some layout
|
||
tweaks.
|
||
|
||
2004-11-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontrollerinfo.c (gimp_controller_info_init):
|
||
always create the event mapping table. Fixes tons of warnings and
|
||
non-functional controller mapping dialog when an empty controller
|
||
was deserialized from controllerrc. Spotted by drc.
|
||
|
||
2004-11-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/app_procs.c (app_exit_after_callback): call base_exit()
|
||
before quitting the application using exit(). Fixes bug #159019.
|
||
|
||
* app/base/tile-swap.c: moved the warning about a non-empty swap
|
||
file into #ifdef GIMP_UNSTABLE ... #endif.
|
||
|
||
2004-11-22 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c: correctly initialize the Antialising
|
||
check box. Reported by Zigomar.
|
||
|
||
2004-11-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-scripts.c: sort the SFMenu structs
|
||
by their menu_paths *and* the procedure's menu_labels. Fixes menu
|
||
item sorting after "Refresh".
|
||
|
||
2004-11-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimptextoptions.[ch] (gimp_text_options_editor_new):
|
||
added a "menu_factory" parameter instead of trying to get it from
|
||
the toplevel GimpDock (which does not exists if the tool options
|
||
dialog does not exist). Fixes bug #159071.
|
||
|
||
* app/tools/gimptexttool.c (gimp_text_tool_editor): pass the
|
||
menu_factory.
|
||
|
||
* app/dialogs/dialogs.c (dialogs_init): pass the global menu
|
||
factory also when constructing the "toplevel" dialog factory so
|
||
the above works.
|
||
|
||
2004-11-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpbase/gimputils.c (gimp_any_to_utf8): use g_strndup()
|
||
instead of g_strdup() if a length was passed.
|
||
|
||
* app/dialogs/info-window.c: g_strndup() the comment parasite's
|
||
data and pass -1 as length to gimp_any_to_utf8() so we don't
|
||
encounter the questionable (buggy?) behavior of g_utf8_validate()
|
||
to fail upon finding '\0' within the "length" passed.
|
||
Fixes bug #159051.
|
||
|
||
2004-11-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/struc.c: applied patch from Wolfgang Hofer
|
||
which makes the plug-in use its procedure name for
|
||
storing the "last_vals" struct. Fixes bug #159028.
|
||
|
||
* plug-ins/common/tileit.c: ditto. Fixes bug #159029.
|
||
|
||
2004-11-22 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-line.c: fixed a stupid bug which made all lines
|
||
half-selected.
|
||
|
||
2004-11-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/file-open-location-dialog.c: changed border-size of
|
||
GimpContainerEntry to 0.
|
||
|
||
2004-11-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/gimp-remote.c: added --no-splash command-line option that
|
||
is passed to gimp. Addresses Debian bug report #277989.
|
||
|
||
* docs/gimp-remote.1.in: document the new option.
|
||
|
||
2004-11-21 Manish Singh <yosh@gimp.org>
|
||
|
||
* configure.in: reverted previous change, as not all the lv.pos are
|
||
in CVS yet.
|
||
|
||
2004-11-21 Peteris Krisjanis <pecisk@gmail.com>
|
||
|
||
* configure.in: Added Latvian (lv) language support to ALL_LINGUAS.
|
||
|
||
2004-11-21 Kevin Cozens <kcozens@cvs.gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/erase-rows.scm: Applied patch from BM
|
||
which makes the script work layers that have their top-left corner
|
||
at a position other than the top-left corner of the image.
|
||
Fixes bug #158863.
|
||
|
||
2004-11-21 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-arc.c
|
||
* plug-ins/gfig/gfig-bezier.c
|
||
* plug-ins/gfig/gfig-circle.c
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-dobject.c
|
||
* plug-ins/gfig/gfig-ellipse.c
|
||
* plug-ins/gfig/gfig-line.c
|
||
* plug-ins/gfig/gfig-poly.c
|
||
* plug-ins/gfig/gfig-spiral.c
|
||
* plug-ins/gfig/gfig-star.c
|
||
* plug-ins/gfig/gfig.h: makes which object is selected more obvious by
|
||
using filled handles for the selected object. Not perfect, but
|
||
certainly a good hint.
|
||
|
||
2004-11-21 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-preview.c: call gfig_grid_colours() in the
|
||
realize callback of the preview, so the gray gc of the grid works
|
||
again. Reported by Zigomar.
|
||
|
||
* plug-ins/gfig/gfig-dobject.c
|
||
* plug-ins/gfig/gfig-preview.h
|
||
* plug-ins/gfig/gfig-spiral.h
|
||
* plug-ins/gfig/gfig-star.h
|
||
* plug-ins/gfig/notes.txt: small cosmetics fixes.
|
||
|
||
2004-11-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/compose.c
|
||
* plug-ins/common/decompose.c: transfer the image resolution to
|
||
newly created images.
|
||
|
||
2004-11-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gimpressionist/Brushes/snow1.pgm: reverted a change
|
||
that Hans Breuer committed here, probably accidentally.
|
||
|
||
* plug-ins/script-fu/script-fu.c
|
||
* plug-ins/script-fu/siod-wrapper.c: reverted Hans's changes. There
|
||
is indeed a Script-Fu server on Win32.
|
||
|
||
2004-11-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* menus/image-menu.xml.in: removed "Quit" from the image menu.
|
||
|
||
2004-09-21 Hans Breuer <hans@breuer.org>
|
||
|
||
* app/dialogs/makefile.msc : [new file]
|
||
app/dialogs/Makefile.am : added to EXTRA_DIST
|
||
|
||
* **/makefile.msc app/gimpcore.def : updated
|
||
|
||
* app/gimp.rc : let wilber be first
|
||
|
||
* app/widgets/gimppropwidgets.c : msvc6 can't cast uint64 either
|
||
|
||
* libgimpbase/gimpwin32-io.h : make up recent loss of ftruncate in GLib
|
||
|
||
* libgimpthumbnail/gimpthumbnail.c : <process.h> for getpid() on win32
|
||
|
||
* plug-ins/helpbrowser/dialog.c : include gimpwin32-io.h
|
||
|
||
* plug-ins/script-fu/siodwrapper.c plug-ins/script-fu/script-fu.c :
|
||
there is no script-fu-server on win32
|
||
|
||
2004-11-21 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* plug-ins/script-fu/scripts/addborder.scm: first resize the
|
||
image, then add the border layer and then fill it
|
||
|
||
2004-11-20 Kevin Cozens <kcozens@cvs.gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-scripts.c: Need to call gettext in
|
||
script-fu_menu_compare. Spotted by Sven. Removed obsolete #define's.
|
||
|
||
2004-11-20 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-scripts.c: renamed variable
|
||
"script_list" to "script_tree" because it's a GTree.
|
||
|
||
(script_fu_remove_script): g_list_free() the right list (don't
|
||
leak all lists of scripts at the tree leaves).
|
||
|
||
2004-11-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* Made 2.2-pre2 release.
|
||
|
||
2004-11-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/glob.c: added an (optional) parameter that
|
||
allows to request the output in the filesystem encoding.
|
||
|
||
2004-11-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-scripts.c (script_fu_menu_compare):
|
||
compare the menu paths, not the struct pointers.
|
||
|
||
2004-11-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/glob.c: added a naive glob() implementation
|
||
which handles the most common use case and is certainly better
|
||
than nothing. Closes bug #143661 again.
|
||
|
||
2004-11-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimp.c: converted a g_warning() to g_printerr().
|
||
|
||
2004-11-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/xpm.c: just some minor code cleanup.
|
||
|
||
2004-11-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-style.c: combined two "Stroke" labels into a
|
||
single one.
|
||
|
||
2004-11-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/noisify.c: applied a (modified) patch that adds
|
||
the possibility to correlate the noise with the signal. Adds the
|
||
new PDB procedure "plug_in_scatter_rgb". Fixes bug #158700.
|
||
|
||
* plug-ins/helpbrowser/dialog.c: set a reasonable default size.
|
||
|
||
2004-11-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/postscript.c (skip_ps) (ps_close): fixed use of
|
||
fread(). Unfortunately this slowed down the plug-in again.
|
||
Disabled the code that reads the pipe to the end. This brings it
|
||
back to speed. Seems to work fine for me, let's see if this causes
|
||
problems for anyone...
|
||
|
||
2004-11-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/selection-round.scm: moved into the
|
||
<Image>/Select/Modify menu now that we can safely use placeholders
|
||
from Script-Fu.
|
||
|
||
2004-11-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/lib.pl
|
||
* tools/pdbgen/stddefs.pdb: added support for deprecated procedures
|
||
without any replacement.
|
||
|
||
* app/plug-in/plug-in-message.c (plug_in_handle_proc_run): added
|
||
a special warning for procedures without replacement.
|
||
|
||
* tools/pdbgen/pdb/drawable.pdb: deprecated drawable_set_image()
|
||
without any replacement and made it a nop (which fails if the
|
||
passed image is different from the drawable's image). It's not
|
||
needed any longer since 2.0 and moreover dangerous to use.
|
||
|
||
* app/pdb/drawable_cmds.c
|
||
* libgimp/gimpdrawable_pdb.[ch]: regenerated.
|
||
|
||
* app/core/gimpitem.c (gimp_item_set_image): replaced assertion
|
||
for gimp_item_is_floating() by !gimp_item_is_attached(). The
|
||
former warned when adding a layer with already added mask to the
|
||
image (which is a perfectly valid operation).
|
||
|
||
2004-11-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/wmf.c: added a thumbnail load procedure
|
||
(bug #158193).
|
||
|
||
2004-11-18 Michael Natterer <mitch@gimp.org>
|
||
|
||
Script-Fu string cleanup/simplification: apply the same fix for
|
||
menu path translation that was done for plug-ins a while ago.
|
||
|
||
* plug-ins/script-fu/script-fu.c (script_fu_auxillary_init): use
|
||
gimp_plugin_menu_register() on the "Refresh" temp_proc.
|
||
|
||
* plug-ins/script-fu/scripts/*.scm: ported all scripts to use
|
||
script-fu-menu-register and pass just the menu label in
|
||
script-fu-register. Cleaned up all register calls to share a
|
||
somewhat similar formatting.
|
||
|
||
2004-11-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/postscript.c: changed the default to load only
|
||
the first page of the document and added a tooltip describing how
|
||
to specify what pages to get.
|
||
|
||
2004-11-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/file/file-open.c (file_open_thumbnail): fixed check for
|
||
number of return values.
|
||
|
||
2004-11-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/postscript.c: speed up loading of multi-page
|
||
documents significantly by skipping in large chunks instead of using
|
||
fgetc() to crawl through the stream.
|
||
|
||
2004-11-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/file/file-open.c (file_open_thumbnail): check the number of
|
||
return values. Only retrieve width and height if the thumbnail
|
||
load procedure does actually provide this information.
|
||
|
||
* plug-ins/common/postscript.c: added a procedure to load a
|
||
thumbnail. For now it only renders the first page of the
|
||
document at low resolution. It should be extended to load an
|
||
embedded thumbnail if one is available.
|
||
|
||
* plug-ins/common/jpeg.c
|
||
* plug-ins/common/svg.c: no need to register a menu label for the
|
||
thumbnail loaders. Allocate the return_vals array large enough to
|
||
hold all return values.
|
||
|
||
2004-11-18 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpenumaction.[ch]: added boolean property
|
||
"value-variable" which specifies if the GimpEnumAction::selected()
|
||
signal may be emitted with arbirtary values (value-variable = TRUE)
|
||
or *only* with enum_action->value (value-variable = FALSE).
|
||
|
||
* app/widgets/gimpactiongroup.[ch]: added "gboolean
|
||
value_variable" to GimpEnumActionEntry and set it in
|
||
gimp_action_group_add_enum_actions().
|
||
|
||
* app/actions/channels-actions.c
|
||
* app/actions/colormap-editor-actions.c
|
||
* app/actions/context-actions.c
|
||
* app/actions/drawable-actions.c
|
||
* app/actions/edit-actions.c
|
||
* app/actions/error-console-actions.c
|
||
* app/actions/gradient-editor-actions.c
|
||
* app/actions/image-actions.c
|
||
* app/actions/layers-actions.c
|
||
* app/actions/palette-editor-actions.c
|
||
* app/actions/plug-in-actions.c
|
||
* app/actions/vectors-actions.c
|
||
* app/actions/view-actions.c: set "variable" to FALSE for all enum
|
||
actions except those which are used with the GIMP_ACTION_SELECT_SET
|
||
voodoo.
|
||
|
||
* app/widgets/gimpcontrollers.c (gimp_controllers_event_mapped):
|
||
fall back to gtk_action_activate() if the action specified in a
|
||
GIMP_CONTROLLER_EVENT_VALUE mapping is not variable. Enables
|
||
triggering of enum actions from GIMP_CONTROLLER_EVENT_VALUE events
|
||
(like midi note-on and note-off).
|
||
|
||
2004-11-18 Michael Natterer <mitch@gimp.org>
|
||
|
||
* acinclude.m4: pasted the complete alsa.m4 so compiling from
|
||
CVS doesn't require alsa.m4 to be installed.
|
||
|
||
* configure.in: check for alsa >= 1.0.0 and define HAVE_ALSA
|
||
if found.
|
||
|
||
* modules/Makefile.am: build controller_midi with ALSA_CFLAGS
|
||
and ALSA_LIBS.
|
||
|
||
* modules/controller_midi.c: s/HAVE_ALSALIB_H/HAVE_ALSA/.
|
||
|
||
2004-11-18 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/compressor.c (compressors): added back the
|
||
.xcf.gz and .xcf.bz2 extensions because they are the only way
|
||
to figure the special nature of this plug-in's extensions.
|
||
|
||
* app/widgets/gimpfileprocview.[ch]: keep a list of "meta
|
||
extensions" (extensions which have a '.' themselves).
|
||
|
||
* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
|
||
try to replace the whole extension if the last extension is one of
|
||
the meta extensions kept by GimpFileProcView. Fixes bug #158377.
|
||
|
||
2004-11-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/maze/maze.[ch]
|
||
* plug-ins/maze/maze_face.c: removed the extra help button from
|
||
the Maze plug-in. Fixes bug #158605.
|
||
|
||
2004-11-18 Michael Natterer <mitch@gimp.org>
|
||
|
||
The following fixes have no visible effect because nobody
|
||
uses gimp_plugin_menu_register() on temp_procs yet:
|
||
|
||
* app/actions/plug-in-actions.[ch]: added
|
||
plug_in_actions_add_path() which just adds the actions needed for
|
||
a given menu math, but not the procedure action itself.
|
||
|
||
* app/gui/gui-vtable.c (gui_menus_create_entry): create the
|
||
menu_path's actions using above function so adding of submenus to
|
||
existing ui managers works.
|
||
|
||
* tools/pdbgen/pdb/plug_in.pdb (plugin_menu_register_invoker):
|
||
don't add a menu if "no_interface" is TRUE.
|
||
|
||
* app/pdb/plug_in_cmds.c: regenerated.
|
||
|
||
* plug-ins/script-fu/script-fu-scripts.c: pass untranslated
|
||
menu_paths to the core, not translated ones. Don't store the
|
||
scripts directly in the "script_list" tree but use a list of
|
||
scripts per key because there can be identical keys for different
|
||
scripts now. Fixed sorting of menu entries and menus.
|
||
|
||
2004-11-18 Simon Budig <simon@gimp.org>
|
||
|
||
* modules/controller_midi.c: implemented support for ALSA-midi,
|
||
currently disabled. Needs a configure-check and proper linking
|
||
against libasound.
|
||
|
||
2004-11-17 Dave Neary <bolsh@gimp.org>
|
||
|
||
* plug-ins/common/bumpmap.c: Fixed initialisation issue
|
||
that was crashing the plug-in on repeat runs. Fixes bug
|
||
#158494.
|
||
|
||
2004-11-17 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/print-size-dialog.c: added missing callbacks for the
|
||
size entries. Needs some more work though...
|
||
|
||
2004-11-17 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/dbbrowser/Makefile.am: make libgimpprocbrowser a libtooled
|
||
library.
|
||
|
||
* plug-ins/dbbrowser/gimpprocbrowser.[ch]: add a user_data pointer
|
||
for GimpProcBrowserApplyCallback.
|
||
|
||
* plug-ins/dbbrowser/gimpprocbrowser.c: only convert the name to
|
||
scheme style if scheme_names in the proc info pane too.
|
||
|
||
* plug-ins/dbbrowser/procedure-browser.c
|
||
* plug-ins/script-fu/script-fu-console.c: pass NULL as user_data.
|
||
|
||
* plug-ins/script-fu/Makefile.am: reference libgimpprocbrowser.la.
|
||
|
||
* plug-ins/pygimp/Makefile.am
|
||
* plug-ins/pygimp/procbrowser.c: new module, which wraps
|
||
libgimprocbrowser.
|
||
|
||
* plug-ins/pygimp/gimpmodule.c
|
||
* plug-ins/pygimp/pygimp.h
|
||
* plug-ins/pygimp/pygimp-pdb.c: export GimpPDBFunction so other
|
||
modules can use it.
|
||
|
||
* plug-ins/pygimp/plug-ins/pdbbrowse.py
|
||
* plug-ins/pygimp/plug-ins/gimpcons.py: use gimpprocbrowser.
|
||
|
||
2004-11-17 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-interface.c: added a utility
|
||
function to reduce code duplication.
|
||
|
||
2004-11-17 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-scripts.[ch]
|
||
* plug-ins/script-fu/siod-wrapper.c: appled patch from Kevin
|
||
Cozens which adds (script-fu-menu-register) and allows scripts to
|
||
register their menu_paths the same undeprecated way as plug-ins.
|
||
Fixes bug #158117.
|
||
|
||
* plug-ins/script-fu/scripts/test-sphere.scm: example how to use
|
||
the new API. Doesn't change strings because test-shpere.scm is an
|
||
untranslated example script.
|
||
|
||
2004-11-17 Michael Natterer <mitch@gimp.org>
|
||
|
||
Made plug-in menu registration work the same way for ordinary and
|
||
temporary procedures. Addresses bug #158117.
|
||
|
||
* app/core/gimp-gui.[ch]: added "const gchar *menu_path" to
|
||
gimp_menus_create_entry().
|
||
|
||
* app/gui/gui-vtable.c (gui_menus_create_entry): if menu_path is
|
||
NULL, behave as before and create an action and its menu entries
|
||
for all the procedure's menu_paths. If it is non-NULL, skip action
|
||
creation and create a menu entry just for that path.
|
||
|
||
* app/plug-in/plug-ins.c (plug_ins_temp_proc_def_add): call
|
||
gimp_menus_create_entry() with a NULL menu path and call it if
|
||
proc_def->menu_paths *or* proc_def->menu_label is non-NULL, so
|
||
it creates at least the procedure's action, even if it has
|
||
no menu_path (yet).
|
||
|
||
* tools/pdbgen/pdb/plug_in.pdb (plugin_menu_register): check both
|
||
the list of procs and temp_procs when trying to register the
|
||
entry. Allow ordinary procedures and extensions to install stuff
|
||
at query() and init() time and allow temp_procs to install stuff
|
||
at any time.
|
||
|
||
* app/pdb/plug_in_cmds.c: regenerated.
|
||
|
||
2004-11-17 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/dbbrowser/gimpprocbox.c
|
||
* plug-ins/dbbrowser/gimpprocbrowser.[ch]
|
||
* plug-ins/dbbrowser/gimpprocview.c: some cleanup in preparation
|
||
of moving it to a more public place.
|
||
|
||
* plug-ins/dbbrowser/procedure-browser.c
|
||
* plug-ins/script-fu/script-fu-console.c: changed accordingly.
|
||
|
||
2004-11-17 Sven Neumann <sven@gimp.org>
|
||
|
||
* Makefile.am (DISTCHECK_CONFIGURE_FLAGS): removed --enable-gtk-doc
|
||
here since it only causes 'make distcheck' to break earlier as usual.
|
||
|
||
2004-11-17 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/rcm/Makefile.am
|
||
* plug-ins/rcm/rcm_callback.c
|
||
* plug-ins/rcm/rcm_dialog.c
|
||
* plug-ins/rcm/rcm_stock.[ch]: applied a patch from Karine Proot
|
||
that replaces the XPM icons with stock icons (bug #140202).
|
||
|
||
* plug-ins/rcm/pixmaps/*.xpm: removed.
|
||
|
||
* plug-ins/Lighting/lighting_stock.c
|
||
* plug-ins/MapObject/mapobject_stock.c
|
||
* plug-ins/gfig/gfig-stock.c: fixed a common but harmless mistake
|
||
in the icon factory code.
|
||
|
||
2004-11-16 Manish Singh <yosh@gimp.org>
|
||
|
||
* app/widgets/gimpvectorstreeview.c: Hide SVG drop g_print under
|
||
be_verbose.
|
||
|
||
2004-11-16 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/pygimp/gimpui.py: Handle placeholder defaults for gimp
|
||
objects (bug #158392). Patch by Joao S. O. Bueno.
|
||
|
||
2004-11-16 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/pygimp/gimpui.py: Use img.name if filename is not
|
||
available (bug #158392). Patch by Joao S. O. Bueno.
|
||
|
||
2004-11-16 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/pygimp/gimpfu.py
|
||
* plug-ins/pygimp/gimpui.py: Add a palette selector (bug #155325).
|
||
Patch by Joao S. O. Bueno.
|
||
|
||
2004-11-16 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/pygimp/gimpfu.py: Fix -fu slider behavior (bug #155103).
|
||
Patch by Joao S. O. Bueno.
|
||
|
||
2004-11-16 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/common/glasstile.c: Remove unnecessary G_OBJECT() casts.
|
||
|
||
2004-11-16 Manish Singh <yosh@gimp.org>
|
||
|
||
* configure.in:
|
||
* plug-ins/pygimp/Makefile.am: Compile pygimp with
|
||
-fno-strict-aliasing if the compiler supports it.
|
||
|
||
* plug-ins/pygimp/gimpui.py: Make "..." into "Browse..." for
|
||
everything but the filesel, for slightly more consistency with
|
||
script-fu. Addresses #124791.
|
||
|
||
* plug-ins/pygimp/gimpmodule.c: Wrapped
|
||
gimp_context_{get,set}_gradient and
|
||
gimp_gradient_get_{uniform,custom}_samples. Deprecated the deprecated
|
||
versions of these, and rewrote them in terms of the new functions.
|
||
|
||
2004-11-17 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/plug-in/plug-in.c (plug_in_close): replaced the
|
||
while(plug_in->temp_procs) "loop" which called
|
||
plug_in_proc_frame_quit() by a real for()-loop iterating over the
|
||
list of PlugInProcFrames, calling g_main_loop_quit() on each main
|
||
loop. The old version did not unroll the stack but looped
|
||
infinitely. Spotted by Yosh.
|
||
|
||
2004-11-17 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/imagemap/imap_selection.c
|
||
* plug-ins/imagemap/imap_preferences.c: silent the compiler.
|
||
|
||
2004-11-17 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/jpeg.c: applied (modified) patch from S. Mukund
|
||
which adds EXIF thumbnail loading and saving.
|
||
Fixes bugs #155761 and #158190.
|
||
|
||
2004-11-16 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-arc.c
|
||
* plug-ins/gfig/gfig-bezier.c
|
||
* plug-ins/gfig/gfig-circle.c
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-ellipse.c
|
||
* plug-ins/gfig/gfig-line.c
|
||
* plug-ins/gfig/gfig-poly.c
|
||
* plug-ins/gfig/gfig-spiral.c
|
||
* plug-ins/gfig/gfig-star.c
|
||
* plug-ins/gfig/gfig-style.c
|
||
* plug-ins/gfig/gfig-style.h
|
||
* plug-ins/gfig/gfig-types.h
|
||
* plug-ins/gfig/gfig.h: added a toggle so we can now choose to stroke
|
||
the painting or not.
|
||
|
||
2004-11-16 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c: implemented the gradient fill, using a
|
||
shapeburst blend. This is very slow, but I dont see how it could be
|
||
done otherwise.
|
||
|
||
2004-11-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpfgbgeditor.c: get rid of the
|
||
gimp_fg_bg_editor_context_changed() callback and
|
||
g_signal_connect_swapped() gtk_widget_queue_draw() directly.
|
||
|
||
2004-11-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpchanneltreeview.c: implement
|
||
GimpDockedInterface::set_context() and set the context of the
|
||
embedded GimpComponentEditor. Fixes NULL-context crashes in
|
||
action callbacks when invoked from the component editor.
|
||
Spotted by Jimmac.
|
||
|
||
Unrelated:
|
||
|
||
* app/widgets/gimpitemtreeview.c: get rid of the
|
||
gimp_item_tree_view_context_changed() callback and
|
||
g_signal_connect_swapped() gimp_item_tree_view_set_image()
|
||
directly.
|
||
|
||
2004-11-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/jigsaw.c: added missing braces around initializer.
|
||
|
||
2004-11-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/drawable_transform.pdb: renamed the new
|
||
drawable_foo_defaults() functions to drawable_foo_default() to be
|
||
consistent with paintbrush_default() and friends.
|
||
|
||
* tools/pdbgen/pdb/transform_tools.pdb
|
||
* libgimp/gimp.def: changed accordingly.
|
||
|
||
* app/pdb/drawable_transform_cmds.c
|
||
* app/pdb/transform_tools_cmds.c
|
||
* libgimp/gimpdrawabletransform_pdb.[ch]
|
||
* libgimp/gimptransformtools_pdb.c: regenerated.
|
||
|
||
* plug-ins/script-fu/scripts/coolmetal-logo.scm
|
||
* plug-ins/script-fu/scripts/image-structure.scm
|
||
* plug-ins/script-fu/scripts/text-circle.scm: follow the API change.
|
||
|
||
2004-11-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/config/gimpbaseconfig.c: increased default tile-cache-size
|
||
to 128MB.
|
||
|
||
* app/config/gimpcoreconfig.c: increased default undo size to 16MB.
|
||
|
||
2004-11-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/image.pdb
|
||
* tools/pdbgen/pdb/selection.pdb: entirely removed the deprecated
|
||
functions "selection_clear", "image_set_cmap" and "image_get_cmap".
|
||
|
||
* app/pdb/procedural_db.c: and added them to the compat hash table
|
||
because they have undeprecated replacements with identical
|
||
signature.
|
||
|
||
* libgimp/gimpselection.[ch]: added gimp_selection_clear() here
|
||
instead because we need the symbol in libgimp.
|
||
|
||
* app/pdb/image_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* app/pdb/selection_cmds.c
|
||
* libgimp/gimpselection_pdb.[ch]: regenerated.
|
||
|
||
2004-11-16 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dobject.h: renamed the DObject type to
|
||
GfigObject, according to our common type naming. This type will
|
||
certainly become an abstract class in a near future.
|
||
|
||
* plug-ins/gfig/gfig-arc.c
|
||
* plug-ins/gfig/gfig-bezier.c
|
||
* plug-ins/gfig/gfig-bezier.h
|
||
* plug-ins/gfig/gfig-circle.c
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-dobject.c
|
||
* plug-ins/gfig/gfig-ellipse.c
|
||
* plug-ins/gfig/gfig-line.c
|
||
* plug-ins/gfig/gfig-line.h
|
||
* plug-ins/gfig/gfig-poly.c
|
||
* plug-ins/gfig/gfig-poly.h
|
||
* plug-ins/gfig/gfig-spiral.c
|
||
* plug-ins/gfig/gfig-star.c
|
||
* plug-ins/gfig/gfig-types.h
|
||
* plug-ins/gfig/gfig.c
|
||
* plug-ins/gfig/gfig.h: changed accordingly.
|
||
|
||
2004-11-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpitem-linked.[ch] (gimp_item_linked_get_list):
|
||
removed redundant "gimage" parameter.
|
||
|
||
* app/tools/gimpeditselectiontool.c: changed accordingly.
|
||
|
||
2004-11-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpchannel-select.c
|
||
* app/core/gimpchannel.c
|
||
* app/core/gimpdrawable-desaturate.c
|
||
* app/core/gimpdrawable-equalize.c
|
||
* app/core/gimpdrawable-histogram.c
|
||
* app/core/gimpdrawable-invert.c
|
||
* app/core/gimpdrawable-levels.c
|
||
* app/core/gimpdrawable-offset.c
|
||
* app/core/gimpdrawable-stroke.c
|
||
* app/core/gimpdrawable-transform.c
|
||
* app/core/gimpdrawable.c
|
||
* app/core/gimpitem-linked.c
|
||
* app/core/gimpitem.c
|
||
* app/core/gimplayer.c
|
||
* app/core/gimpselection.c
|
||
* app/paint/gimppaintcore-stroke.c
|
||
* app/text/gimptextlayer.c: in all functions which somehow
|
||
(explicitely or implicitely) touch undo, either g_return_if_fail()
|
||
on gimp_item_is_attached() or simply don't push an undo step if
|
||
feasible (e.g. for simple stuff like layer opacity).
|
||
|
||
* tools/pdbgen/pdb/color.pdb
|
||
* tools/pdbgen/pdb/drawable.pdb
|
||
* tools/pdbgen/pdb/image.pdb
|
||
* tools/pdbgen/pdb/layer.pdb
|
||
* tools/pdbgen/pdb/paint_tools.pdb: let PDB wrappers fail
|
||
accordingly so they don't run into the assertions added above.
|
||
|
||
* app/pdb/color_cmds.c
|
||
* app/pdb/drawable_cmds.c
|
||
* app/pdb/image_cmds.c
|
||
* app/pdb/layer_cmds.c
|
||
* app/pdb/paint_tools_cmds.c: regenerated.
|
||
|
||
2004-11-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/file-commands.c
|
||
* app/dialogs/file-save-dialog.c
|
||
* app/file/file-save.[ch]
|
||
* app/widgets/gimpfiledialog.[ch]: combined "set_uri_and_proc" and
|
||
"set_image_clean" parameters into a single "save_a_copy"
|
||
parameter. When saving a copy, attach the used URI to the image and
|
||
let the "Save a Copy" file chooser default to the last used value.
|
||
|
||
2004-11-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/glossy.scm: fixed typo (bug #158425).
|
||
|
||
2004-11-15 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig.c: added a blurb proposed by Alan Horkan.
|
||
|
||
* plug-ins/gfig/gfig-line.[ch]: smallish style fix.
|
||
|
||
2004-11-15 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/images/stock-ellipse.png: better icon for the ellipse
|
||
tool (a lot more elliptical) by Jimmac and Zigomar.
|
||
|
||
2004-11-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
|
||
limit the number of file extensions that are added to the file
|
||
filter menu to keep the file dialog from growing too wide.
|
||
|
||
2004-11-15 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/display/gimpdisplayshell-preview.c: Further optimization of
|
||
perspective tool preview - never calculate the same vertex more
|
||
than once.
|
||
|
||
2004-11-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpfileprocview.c (gimp_file_proc_view_get_proc)
|
||
* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
|
||
better fix for bug #158369.
|
||
|
||
2004-11-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
|
||
return early if gimp_file_proc_view_get_proc() didn't return a file
|
||
procedure. Should fix bug #158369.
|
||
|
||
2004-11-15 Øyvind Kolås <pippin@gimp.org>
|
||
|
||
* docs/gimp.txt: removed, outdated.
|
||
* docs/make_todo: removed, unused.
|
||
|
||
2004-11-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/print-size-dialog.c: started to redo this dialog
|
||
without using a GimpSizeBox. The widgets aren't connected, so it
|
||
isn't usable yet.
|
||
|
||
* app/widgets/gimpprogressbox.c
|
||
* app/widgets/gimpprogressdialog.c
|
||
* app/widgets/gimpsizebox.c: trivial cleanups.
|
||
|
||
* data/images/gimp-splash.png: splash for 2.2-pre2, done by Jimmac.
|
||
|
||
2004-11-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/image-commands.c: converted error messages that should
|
||
never appear to warnings.
|
||
|
||
2004-11-14 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-dobject.c
|
||
* plug-ins/gfig/gfig-dobject.h: fixed a crash (the one triggered by
|
||
this sequence: draw a line, delete it, redraw something), and
|
||
corrected some ui spacing.
|
||
|
||
2004-11-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimppalette-import.c: applied a (slightly modified)
|
||
patch from Nickolay V. Shmyrev that changes the palette import
|
||
function to not only read palettes in the RIFF format but also
|
||
GIMP and Photoshop ACT palette files (bug #158297).
|
||
|
||
2004-11-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* Makefile.am (EXTRA_DIST)
|
||
* MAINTAINERS
|
||
* PLUGIN_MAINTAINERS
|
||
* TODO.xml: removed these files from the tarball and from CVS.
|
||
Doesn't make sense to keep unmaintained files around that provide
|
||
outdated and in large parts wrong information.
|
||
|
||
2004-11-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c (load_button_callback): use the
|
||
proper parent widget.
|
||
|
||
2004-11-14 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-types.h: small UI tweaks, suggested by Sven.
|
||
|
||
2004-11-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* configure.in
|
||
* plug-ins/rcm/Makefile.am
|
||
* plug-ins/rcm/images/Makefile.am
|
||
* plug-ins/rcm/images/rcm-360.png
|
||
* plug-ins/rcm/images/rcm-a-b.png
|
||
* plug-ins/rcm/images/rcm-ccw.png
|
||
* plug-ins/rcm/images/rcm-cw.png: added PNG versions of the XPM
|
||
icons used by the RCM plug-in. Added rules to build a header file
|
||
that can be used to get rid of the XPM files (bug #140202).
|
||
|
||
2004-11-14 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-dialog.h
|
||
* plug-ins/gfig/gfig-dobject.c
|
||
* plug-ins/gfig/gfig-dobject.h
|
||
* plug-ins/gfig/gfig-types.h
|
||
* plug-ins/gfig/gfig.c
|
||
* plug-ins/gfig/gfig.h: replace the crappy DAllObjs struct by a GList.
|
||
Makes the code cleaner and less error prone.
|
||
|
||
2004-11-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/pagecurl/pagecurl.c: applied a patch from Karine Proot
|
||
that replaces the XPM icons with pixbufs (bug #140202).
|
||
|
||
* plug-ins/pagecurl/curl[0-7].xpm: removed.
|
||
|
||
2004-11-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gimpressionist/Makefile.am: fixed typo.
|
||
|
||
* plug-ins/pagecurl/Makefile.am
|
||
* plug-ins/pagecurl/curl[0-7].png: added PNG versions of the XPM
|
||
icons used by the PageCurl plug-in. Added rules to build a header
|
||
file that can be used to get rid of the XPM files (bug #140202).
|
||
|
||
2004-11-14 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/display/gimpdisplayshell-preview.c: Eliminated about 396
|
||
floating-point divides per frame in the persective preview.
|
||
|
||
2004-11-13 Manish Singh <yosh@gimp.org>
|
||
|
||
Fix a bunch of warnings from Sparse:
|
||
|
||
* app/actions/dockable-commands.c
|
||
* app/actions/layers-actions.c
|
||
* app/actions/view-commands.c
|
||
* app/base/pixel-surround.c
|
||
* app/config/gimpconfig-utils.c
|
||
* app/config/gimpscanner.c
|
||
* app/core/gimpbrushgenerated.c
|
||
* app/core/gimpcontainer.c
|
||
* app/core/gimpimage.c
|
||
* app/dialogs/palette-import-dialog.c
|
||
* app/file/gimprecentlist.c
|
||
* app/plug-in/plug-in-params.c
|
||
* app/text/gimptext-compat.c
|
||
* app/text/gimptext-parasite.c
|
||
* app/vectors/gimpbezierstroke.c
|
||
* app/vectors/gimpstroke.c
|
||
* app/widgets/gimpcellrendereraccel.c
|
||
* app/widgets/gimpselectiondata.c
|
||
* app/xcf/xcf.c
|
||
* libgimp/gimp.c
|
||
* libgimpthumb/gimpthumb-utils.c
|
||
* libgimpthumb/gimpthumbnail.c
|
||
* modules/cdisplay_proof.c
|
||
* plug-ins/Lighting/lighting_ui.c
|
||
* plug-ins/common/csource.c
|
||
* plug-ins/common/glasstile.c
|
||
* plug-ins/common/nova.c
|
||
* plug-ins/common/pcx.c
|
||
* plug-ins/common/pnm.c
|
||
* plug-ins/common/randomize.c
|
||
* plug-ins/common/screenshot.c
|
||
* plug-ins/common/sel_gauss.c
|
||
* plug-ins/common/spheredesigner.c
|
||
* plug-ins/common/wind.c
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-dobject.c
|
||
* plug-ins/gimpressionist/gimpressionist.c
|
||
* plug-ins/ifscompose/ifscompose.c
|
||
* plug-ins/print/gimp_main_window.c
|
||
* plug-ins/print/print.c: Cleanup integer vs. pointer confusion.
|
||
|
||
* app/base/temp-buf.c
|
||
* app/dialogs/about-dialog.c
|
||
* plug-ins/common/bumpmap.c
|
||
* plug-ins/common/jigsaw.c
|
||
* plug-ins/gfig/gfig-dobject.c: Cosmetic cleanups.
|
||
|
||
* app/config/gimpconfig-deserialize.c
|
||
* app/config/gimpconfig-path.c
|
||
* app/config/gimpconfigwriter.c
|
||
* app/core/gimpgradient.c
|
||
* app/tools/gimpdrawtool.c
|
||
* plug-ins/common/nlfilt.c
|
||
* plug-ins/common/unsharp.c
|
||
* plug-ins/common/zealouscrop.c: Define inline functions before they
|
||
are used.
|
||
|
||
* app/core/gimpdrawable-blend.c: PixelRegion definition was changed
|
||
some time ago, but the initialization here didn't change. Fix it.
|
||
|
||
* app/plug-in/plug-in-rc.c (plug_in_extra_deserialize): No need to
|
||
assign token twice in a row.
|
||
|
||
* libgimpbase/gimpdatafiles.c (gimp_datafiles_read_directories): No
|
||
need to initialize file_data, since the code fills out all the fields.
|
||
|
||
* plug-ins/common/CML_explorer.c
|
||
* plug-ins/common/vpropagate.c: Declare function pointers fully.
|
||
|
||
* plug-ins/common/grid.c (pix_composite): G_INLINE_FUNC isn't needed,
|
||
we assume we can use the "inline" keyword always.
|
||
|
||
* plug-ins/common/psd_save.c
|
||
* plug-ins/common/vinvert.c
|
||
* plug-ins/gfig/gfig-arc.c
|
||
* plug-ins/gfig/gfig-bezier.c
|
||
* plug-ins/gfig/gfig-circle.c
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-dobject.c
|
||
* plug-ins/gfig/gfig-ellipse.c
|
||
* plug-ins/gfig/gfig-line.c
|
||
* plug-ins/gfig/gfig-poly.c
|
||
* plug-ins/gfig/gfig-spiral.c
|
||
* plug-ins/gfig/gfig-star.c
|
||
* plug-ins/gfig/gfig.c
|
||
* plug-ins/gimpressionist/orientmap.c
|
||
* plug-ins/gimpressionist/placement.c
|
||
* plug-ins/gimpressionist/sizemap.c
|
||
* plug-ins/imagemap/imap_grid.c
|
||
* plug-ins/imagemap/imap_main.c
|
||
* plug-ins/imagemap/imap_preferences.c
|
||
* plug-ins/imagemap/imap_settings.c
|
||
* plug-ins/maze/maze.c
|
||
* plug-ins/sel2path/curve.c
|
||
* plug-ins/sel2path/fit.c
|
||
* plug-ins/sel2path/pxl-outline.c
|
||
* plug-ins/sel2path/spline.c
|
||
* plug-ins/xjt/xjt.c: Functions with no args should be declared
|
||
with (void).
|
||
|
||
* plug-ins/common/retinex.c (MSRCR): Initialize max_preview to quiet
|
||
the compiler.
|
||
|
||
2004-11-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* themes/Default/images/Makefile.am
|
||
* themes/Default/images/stock-center-16.png
|
||
* themes/Default/images/stock-center-24.png
|
||
* themes/Default/images/stock-print-resolution-16.png
|
||
* themes/Default/images/stock-print-resolution-24.png: new icons
|
||
drawn by Jimmac.
|
||
|
||
* libgimpwidgets/gimpstock.[ch]: registered the new icons.
|
||
|
||
* app/actions/image-actions.c
|
||
* app/dialogs/print-size-dialog.c
|
||
* app/dialogs/resize-dialog.c
|
||
* plug-ins/ifscompose/ifscompose.c: use them.
|
||
|
||
2004-11-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* configure.in: bumped version to 2.2-pre2.
|
||
|
||
2004-11-13 Manish Singh <yosh@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/image.pdb: Adapted Sven's code into pdbgen so
|
||
that gimp_image_set_filename() validates that it is called with
|
||
a filename in the filesystem encoding which can safely be converted
|
||
to UTF-8 and back. Fixes #153751.
|
||
|
||
* app/pdb/image_cmds.c
|
||
* libgimp/gimpimage_pdb.c: Regenerated.
|
||
|
||
2004-11-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/Makefile.am
|
||
* app/dialogs/print-size-dialog.[ch]: new files for the Print Size
|
||
dialog that was missing. Still work in progress...
|
||
|
||
* app/actions/image-actions.c
|
||
* app/actions/image-commands.[ch]
|
||
* app/widgets/gimphelp-ids.h
|
||
* menus/image-menu.xml.in: integrate the new dialog.
|
||
|
||
2004-11-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/selection.pdb: deprecate gimp_selection_clear()
|
||
in favor of gimp_selection_none(). Fixes bug #156765.
|
||
|
||
* app/pdb/selection_cmds.c
|
||
* libgimp/gimpselection_pdb.[ch]: regenerated.
|
||
|
||
2004-11-13 Kevin Cozens <kcozens@cvs.gimp.org>
|
||
|
||
* plug-ins/gfig/gfig.c
|
||
* plug-ins/gfig/gfig-dialog.c: Changed gimp_selection_clear() to
|
||
gimp_selection_none() (bug #156765).
|
||
|
||
2004-11-13 Kevin Cozens <kcozens@cvs.gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/gimp-headers.scm
|
||
* plug-ins/script-fu/scripts/gimp-labels.scm
|
||
* plug-ins/script-fu/scripts/news-text.scm
|
||
* plug-ins/script-fu/scripts/speed-text.scm: Changed calls to
|
||
gimp-selection-clear to use gimp-selection-none in preparation
|
||
for the deprecation of -clear. (bug #156765)
|
||
|
||
2004-11-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/image.pdb: document the fact that
|
||
gimp_image_get_filename() returns the filename in the filesystem
|
||
encoding. Fixed gimp_image_get_name() to actually return the name
|
||
in UTF-8 encoding.
|
||
|
||
* app/pdb/image_cmds.c
|
||
* libgimp/gimpimage_pdb.c: Regenerated.
|
||
|
||
* app/vectors/gimpbezierstroke.h: formatting.
|
||
|
||
2004-11-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpimagefile.[ch]
|
||
* app/file/file-open.c
|
||
* app/file/file-save.c: pass the MIME type from the save procedure
|
||
to gimp_imagefile_save_thumbnail() so that it can be stored with
|
||
the thumbnail.
|
||
|
||
* tools/pdbgen/pdb/fileops.pdb
|
||
* app/pdb/fileops_cmds.c: changed accordingly.
|
||
|
||
2004-11-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/plug-in/plug-in-proc-def.[ch]
|
||
* app/plug-in/plug-in-rc.c
|
||
* app/plug-in/plug-ins.[ch]: allow to associate a procedure for
|
||
thumbnail loading with any file load procedure.
|
||
|
||
* tools/pdbgen/pdb/fileops.pdb: export this functionality to the
|
||
PDB as gimp_register_thumbnail_loader().
|
||
|
||
* app/pdb/fileops_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* libgimp/gimpfileops_pdb.[ch]: regenerated.
|
||
|
||
* app/core/gimpimagefile.c
|
||
* app/file/file-open.[ch]: when creating a thumbnail for an image
|
||
file, use a thumbnail load procedure if available.
|
||
|
||
* plug-ins/common/svg.c: added "file_svg_load_thumb", a procedure
|
||
that allows to load a small preview of the SVG image.
|
||
|
||
2004-11-13 DindinX <dindinx@gimp.org>
|
||
|
||
* app/actions/layers-actions.c: added back <control>H as a shortcut
|
||
for "Anchor Layer". Spotted by Bruno Ronzani.
|
||
|
||
2004-11-13 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/retinex.c: use a GimpAspectPreview instead of a
|
||
GimpDrawablePreview. Fixes bug #157915. Also fixed the funny behaviour
|
||
of the progress bar.
|
||
|
||
2004-11-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpbase/gimputils.c (gimp_strip_uline): changed based on a
|
||
patch by Joao S. O. Bueno to remove mnemonics as used in languages
|
||
like Chinese. Fixes bug #157561.
|
||
|
||
2004-11-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/ifscompose/README.ifscompose: updated link to the
|
||
tutorial (pointed out by Alan Horkan) and added another link.
|
||
|
||
* plug-ins/ifscompose/ifscompose.c: changed plug-in name from
|
||
"IfsCompose" to "IFS Fractal". Sorry for the late string changes
|
||
but the old name definitely was akward and probably hard to
|
||
translate anyway. Fixes bug #157135.
|
||
|
||
* plug-ins/ifscompose/ifscompose_storage.c: removed trailing
|
||
whitespace.
|
||
|
||
2004-11-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/retinex.c (retinex_dialog): fixed table size.
|
||
|
||
2004-11-13 Simon Budig <simon@gimp.org>
|
||
|
||
* app/core/gimpimage-merge.c: Return the active layer instead of
|
||
the bottom layer when just merging down a floating selection.
|
||
Untabbified.
|
||
|
||
Fixes bug #158130.
|
||
|
||
2004-11-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/config/gimpconfig-dump.c: better fix for bug #157971.
|
||
|
||
* docs/gimprc.5.in: regenerated.
|
||
|
||
2004-11-12 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/images/stock-show-all.png
|
||
* plug-ins/gfig/images/stock-select-object.png: new icons made by
|
||
Jimmac.
|
||
|
||
2004-11-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpimage-undo-push.c: disallow non-attached items
|
||
to be pushed to the undo stack.
|
||
|
||
2004-11-12 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/images/stock-show-all.png
|
||
* plug-ins/gfig/images/stock-select-object.png: added these two stock
|
||
icons. Jimmac, these two are screaming to be redone, please.
|
||
|
||
* plug-ins/gfig/images/Makefile.am: added these icons.
|
||
|
||
* plug-ins/gfig/gfig-bezier.c
|
||
* plug-ins/gfig/gfig-bezier.h
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-poly.c
|
||
* plug-ins/gfig/gfig-poly.h
|
||
* plug-ins/gfig/gfig-spiral.c
|
||
* plug-ins/gfig/gfig-spiral.h
|
||
* plug-ins/gfig/gfig-star.c
|
||
* plug-ins/gfig/gfig-star.h
|
||
* plug-ins/gfig/gfig-stock.c
|
||
* plug-ins/gfig/gfig-stock.h
|
||
* plug-ins/gfig/gfig.h: moved all the buttons to a GtkUIManager
|
||
toolbar, which makes the code simpler and easier to read.
|
||
|
||
2004-11-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/tips-dialog.c: added icons to the Previous/Next
|
||
buttons (bug #158004).
|
||
|
||
2004-11-11 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/splash.c: lowered labels a few pixels.
|
||
|
||
2004-11-11 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c: minor code cleanup.
|
||
|
||
2004-11-11 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c: use a GtkUIManager for the menu and
|
||
automagically have it translated! The button bar will follow the same
|
||
path. Remove the now useless "Paint" button.
|
||
|
||
2004-11-11 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/config/gimpconfig-dump.c: groff doesn't like lines to start
|
||
with a single quote, we better escape it. Fixes bug #157971.
|
||
|
||
* docs/gimprc.5.in: regenerated.
|
||
|
||
2004-11-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimp-edit.c
|
||
* app/core/gimpdrawable-blend.c
|
||
* app/core/gimpdrawable-bucket-fill.c
|
||
* app/core/gimpitem.c (gimp_item_stroke): added precondition
|
||
checks for gimp_item_is_attached() and removed checks for
|
||
gimp_item_get_image() to actually return an image (because it
|
||
always returns an image).
|
||
|
||
* tools/pdbgen/pdb/edit.pdb: let all wrappers fail if the drawable
|
||
is not attached.
|
||
|
||
* app/pdb/edit_cmds.c: regenerated.
|
||
|
||
2004-11-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/add-bevel.scm
|
||
* plug-ins/script-fu/scripts/addborder.scm
|
||
* plug-ins/script-fu/scripts/carve-it.scm
|
||
* plug-ins/script-fu/scripts/carved-logo.scm
|
||
* plug-ins/script-fu/scripts/chip-away.scm
|
||
* plug-ins/script-fu/scripts/clothify.scm
|
||
* plug-ins/script-fu/scripts/font-map.scm
|
||
* plug-ins/script-fu/scripts/slide.scm
|
||
* plug-ins/script-fu/scripts/swirltile.scm: don't call gimp-edit-*
|
||
functions on drawables which are not added to an image because
|
||
this will be forbidden soon (because it can trash the image's undo
|
||
stack).
|
||
|
||
2004-11-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/lava.scm: replaced
|
||
undo-disable/enable by undo-group-start/end.
|
||
|
||
2004-11-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimpimagemaptool.c (gimp_image_map_tool_response):
|
||
call gimp_image_flush() after committing the image_map so the
|
||
menus are up-to-date. Fixes bug #157914.
|
||
|
||
2004-11-11 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/display/gimpdisplayshell-preview.c: Use the transform
|
||
tool coordinates when creating subdivisions, not the
|
||
texture coordinates. Fixes breakage with layers that are not
|
||
the image size.
|
||
|
||
2004-11-11 Jay Cox <jaycox@gimp.org>
|
||
|
||
* app/base/brush-scale.c: Keep computed brush values from
|
||
overflowing with large reduction factors. Fixes bug #76228.
|
||
|
||
2004-11-11 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpintstore.c
|
||
* app/vectors/gimpvectors-import.c: please the overly pedantic
|
||
IRIX MIPSpro compiler and don't initialize structs with
|
||
non-constant values.
|
||
|
||
2004-11-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/file/file-open.c (file_open_layer): add the image to the
|
||
list of recently used documents. Fixes bug #157879.
|
||
|
||
2004-11-10 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c: moved the tool options closer to the
|
||
tools and made the dialog a bit smaller.
|
||
|
||
2004-11-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/mail.c: added a menu icon (compiled-in).
|
||
|
||
2004-11-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-handlers.c
|
||
(gimp_display_shell_resolution_changed_handler): if dot_for_dot is
|
||
off, resolution change has the same effect as size change, so call
|
||
gimp_display_shell_size_changed_handler(). Fixes display garbage.
|
||
|
||
2004-11-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/winicon/icodialog.[ch]
|
||
* plug-ins/winicon/icoload.[ch]
|
||
* plug-ins/winicon/icosave.[ch]
|
||
* plug-ins/winicon/main.[ch]: call progress functions
|
||
unconditionally; removed global "interactive" variable; use
|
||
standard strings for open/save progress messages; gui, indentation
|
||
& coding style cleanup; untabified.
|
||
|
||
2004-11-10 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* plug-ins/winsnap/winsnap.c: applied a patch from Sven Neumann
|
||
with some minor modifications. Fixes bug #157612
|
||
Removed some unused variables.
|
||
|
||
2004-11-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpbase/gimputils.c (gimp_escape_uline): "Since: GIMP 2.2".
|
||
|
||
2004-11-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/preferences-dialog.c: set the padding-mode to custom
|
||
color if a custom color is choosen. Fixes bug #157844.
|
||
|
||
2004-11-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/dbbrowser/plugin-browser.c (browser_dialog_new): fixed
|
||
capitalization of notebook tab label.
|
||
|
||
2004-11-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpbase/gimputils.[ch]: renamed gimp_flags_get_value() to
|
||
gimp_flags_get_first_value(). Reordered functions so enum and
|
||
flags functions are grouped together. Added missing docs.
|
||
|
||
* libgimpbase/gimpbase.def: changed accordingly.
|
||
|
||
2004-11-09 Jay Cox <jaycox@gimp.org>
|
||
|
||
* plug-ins/common/psd.c: Skip resources with unknown signatures
|
||
instead of quiting. Fixes bug #142468, and bug #152728
|
||
|
||
* app/core/gimpdrawable.c: in functions gimp_drawable_mask_bounds,
|
||
and gimp_drawable_mask_intersect: reinitialize the return values
|
||
after calling gimp_channel_bounds because gimp_channel_bounds
|
||
overwrites the values even when it returns false. This fixes the
|
||
bug where the gimp crashes when running color tools on layers
|
||
smaller than the image, and processes only part of the image when
|
||
the layer is larger than the image size.
|
||
|
||
2004-11-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* HACKING: some updates.
|
||
|
||
2004-11-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/ifscompose/ifscompose.c: use a UI manager created
|
||
toolbar instead of two rows of buttons. Added a "dummy-menubar" so
|
||
the popup menu shows shortcuts again. Removed "Preview" and "Auto"
|
||
buttons since the preview doesn't block the GUI and can always be
|
||
updated.
|
||
|
||
2004-11-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpstatusbar.[ch]: added new function
|
||
gimp_statusbar_push_length(), which works exactly like
|
||
push_coords() but takes only one value plus a GimpOrientationType
|
||
for specifying the value's axis.
|
||
|
||
* app/tools/gimptool.[ch]: added the corresponding
|
||
gimp_tool_push_status_length().
|
||
|
||
* app/tools/gimpmovetool.c: use gimp_tool_push_status_length()
|
||
so the guide position is shown in the selected display unit.
|
||
Cleaned up the status message code a bit.
|
||
|
||
2004-11-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/helpbrowser/dialog.c: use an idle handler to jump to the
|
||
anchor.
|
||
|
||
2004-11-09 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/common/bmpread.c: if the file has space in the colormap for
|
||
more than 256 entries, ignore them instead of failing. Fixes bug
|
||
#157775.
|
||
|
||
2004-11-09 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/common/bmpread.c: Fix cut'n'paste err so grayscale images
|
||
load again. Fixes bug #157764.
|
||
|
||
2004-11-09 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-callbacks.c
|
||
(gimp_display_shell_canvas_tool_events): pass (gint)-truncated
|
||
coordinates instead of RINT()-rounded ones to
|
||
gimp_display_shell_update_cursor(). Restores correct coordinates
|
||
display for zoomed-in display and fixes bug #153534.
|
||
|
||
* app/tools/gimpmovetool.c: added statusbar messages including the
|
||
(rounded) guide coordinate. Keeps bug #141719 closed.
|
||
|
||
2004-11-09 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell.c (gimp_display_shell_new): don't
|
||
connect to "event" and don't connect any canvas event to
|
||
gimp_display_shell_events(). Connect all tool events separately
|
||
(doesn't include "configure-event" and thus fixes bug #141543).
|
||
|
||
* app/display/gimpdisplayshell-callbacks.c
|
||
(gimp_display_shell_canvas_tool_events): call
|
||
gimp_display_shell_events() manually before doing tool event
|
||
processing.
|
||
|
||
* app/display/gimpdisplayshell.c
|
||
* app/display/gimpdisplayshell-callbacks.[ch]: connect to
|
||
"size_allocate" of the canvas, not to "configure_event"
|
||
(suggested by Owen in bug #141543).
|
||
|
||
* app/display/gimpdisplayshell-callbacks.[ch]: removed
|
||
gimp_display_shell_popup_menu().
|
||
|
||
(gimp_display_shell_origin_button_press): emit "popup-menu" on the
|
||
shell manually instead of calling above function.
|
||
|
||
* app/display/gimpdisplayshell.c: added the whole menu popup code
|
||
here.
|
||
|
||
2004-11-09 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpoffsetarea.c (gimp_offset_area_resize): queue
|
||
a resize. Fixes remaining issues with bug #157495.
|
||
|
||
2004-11-09 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/url.c: removed debug output.
|
||
|
||
2004-11-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/user-install-dialog.c (user_install_migrate_files):
|
||
don't copy menurc, the format changed anyway.
|
||
|
||
2004-11-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-interface.c (script_fu_ok):
|
||
actually retrieve the value from the GtkEntry for SF-VALUE.
|
||
|
||
2004-11-08 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/layer.pdb: applied modified patch from Geert
|
||
Jordaens which adds the missing gimp_layer_from_mask() API.
|
||
Addresses bug #138662.
|
||
|
||
* app/pdb/internal_procs.c
|
||
* app/pdb/layer_cmds.c
|
||
* libgimp/gimplayer_pdb.[ch]. regenerated.
|
||
|
||
* libgimp/gimp.def: changed accordingly.
|
||
|
||
2004-11-08 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/selection-round.scm: removed garbage
|
||
from beginning of file. Removed DOS line breaks.
|
||
|
||
2004-11-08 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimp/gimppixelfetcher.c: added docs derived from a patch from
|
||
Cai Qian (bug #156271).
|
||
|
||
2004-11-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/screenshot.c: changed label of default action
|
||
button to "Grab".
|
||
|
||
2004-11-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/CEL.c
|
||
* plug-ins/common/CML_explorer.c
|
||
* plug-ins/common/channel_mixer.c
|
||
* plug-ins/common/gqbist.c
|
||
* plug-ins/common/spheredesigner.c
|
||
* plug-ins/flame/flame.c
|
||
* plug-ins/ifscompose/ifscompose.c: don't set help-ids on plug-in
|
||
file chooser dialogs. Set the default response for file dialogs.
|
||
|
||
2004-11-08 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/resize-dialog.c (resize_dialog_response)
|
||
* app/dialogs/scale-dialog.c (scale_dialog_response): replaced
|
||
"case GTK_RESPONSE_CANCEL:" by "default:" so it also catches
|
||
hitting the escape key or clicking the WM close button.
|
||
|
||
2004-11-08 Øyvind Kolås <pippin@gimp.org>
|
||
|
||
* plug-ins/common/gqbist.c: fixed typo in construction of file
|
||
chooser, use gtk_dialog_run instead of separate callbacks for
|
||
the responses of the file chooser dialog.
|
||
|
||
2004-11-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpdrawable.c (gimp_drawable_mask_bounds)
|
||
(gimp_drawable_mask_intersect): initialize the return values before
|
||
checking if the drawable is attached. Keeps GIMP from going mad if
|
||
this assertion is ever triggered.
|
||
|
||
2004-11-07 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/helpbrowser/dialog.c: don't connect the help browser to
|
||
the help system.
|
||
|
||
2004-11-07 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/selection-round.scm: register the
|
||
compatibility procedure with the correct name.
|
||
|
||
2004-11-07 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcolorbutton.c: fixed unused code (tooltip was
|
||
taken from label field).
|
||
|
||
2004-11-07 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/ifscompose/ifscompose.c: ported to GtkUIManager.
|
||
|
||
2004-11-07 Sigurd Gartmann <sigurd-translate@brogar.org>
|
||
|
||
* configure.in: Added support for the new locale nb to ALL_LINGUAS.
|
||
|
||
2004-11-07 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/channel_mixer.c (query): the menu label should
|
||
have three dots (bug #157580).
|
||
|
||
2004-11-07 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gflare/gflare.c: removed #undef GTK_DISABLE_DEPRECATED and
|
||
use a GtkListStore instead of the long-time deprecated GtkList. Done
|
||
some small cleanups, too.
|
||
|
||
2004-11-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpbrushgenerated.c: changed minimum brush radius from
|
||
1.0 to 0.1.
|
||
|
||
* app/widgets/gimpbrusheditor.c: allow a smaller brush radius to
|
||
be set in the brush editor. Fixes bug #157508.
|
||
|
||
2004-11-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/scale-dialog.c (scale_dialog_reset): same fix here.
|
||
|
||
2004-11-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/preferences-dialog.c: fixed typo (bug #157513).
|
||
|
||
2004-11-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/convert-dialog.c (convert_dialog_new): removed
|
||
trailing period from check button label. Fixes bug #157511.
|
||
|
||
2004-11-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/resize-dialog.c (resize_dialog_reset): fixed most of
|
||
the Reset functionality (bug #157495). The offset box is still not
|
||
working correctly.
|
||
|
||
* app/widgets/gimpsizebox.c (gimp_size_box_update_resolution):
|
||
check for availability of the size entry before accessing it.
|
||
|
||
2004-11-06 Sven Neumann <sven@gimp.org>
|
||
|
||
New Win32 icons contributed by Jernej Simoncic:
|
||
|
||
* app/Makefile.am
|
||
* app/makefile.msc
|
||
* app/gimp.rc
|
||
* app/fileicon.ico: added new file icon for the Win32 build.
|
||
|
||
* app/wilber.ico: nicer application icon for the Win32 build.
|
||
|
||
2004-11-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/maze/maze.c
|
||
* plug-ins/maze/maze_face.c: some irrelevant cleanups while doing
|
||
code review.
|
||
|
||
2004-11-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/flame/flame.c: removed #undef GTK_DISABLE_DEPRECATED
|
||
because it's no longer needed. Cleaned up #defines and
|
||
declarations. Removed tabs and trailing whitespace.
|
||
|
||
2004-11-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpsessioninfo.c: be more tolerant and silently
|
||
skip entries that the dialog factory doesn't recognize.
|
||
|
||
* app/widgets/gimpdialogfactory.c: minor cleanup.
|
||
|
||
2004-11-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/user-install-dialog.c (user_install_response): don't
|
||
save the (empty) gimprc after migrating the user settings.
|
||
|
||
2004-11-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/uniteditor.c: undeprecated by using a
|
||
GtkUIManager for creating the toolbar. Some cleanup and code
|
||
reordering.
|
||
|
||
2004-11-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* configure.in: disable the whole bunch of FOO_DISABLE_DEPRECATED
|
||
only for future versions of GLib, GTK+ and Pango because the
|
||
upcoming new stable versions add no new deprecations that are
|
||
relevant for the GIMP source.
|
||
|
||
2004-11-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/ifscompose/ifscompose.c: some undeprecation and
|
||
cleanup. Still uses GtkItemFactory.
|
||
|
||
2004-11-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
Don't use deprecated GtkToolbar API in GimpTextEditor:
|
||
|
||
* app/actions/Makefile.am
|
||
* app/actions/actions.c
|
||
* app/actions/text-editor-actions.[ch]
|
||
* app/actions/text-editor-commands.[ch]: added acions and
|
||
callbacks for the new "text-editor" action group.
|
||
|
||
* app/menus/menus.c: register a "<TextEditor>" UI manager.
|
||
|
||
* menus/Makefile.am
|
||
* menus/text-editor-toolbar.xml: new file for the toolbar.
|
||
|
||
* app/widgets/gimptexteditor.[ch]: use the toolbar created by the
|
||
UI manager instead of constructing it using deprecated API.
|
||
|
||
* app/tools/gimptextoptions.c: changed accordingly.
|
||
|
||
* app/widgets/gimpwidgets-utils.[ch]: added gimp_text_buffer_load()
|
||
(used by text-editor-commands.c).
|
||
|
||
2004-11-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/ifscompose/ifscompose.c: #undef GTK_DISABLE_DEPRECATED.
|
||
|
||
2004-11-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcolorbutton.[ch]: use a GtkUIManager instead
|
||
of a GtkItemFactory. Added virtual function ::get_action_type()
|
||
and create the manager's actions manually using that action type
|
||
instead of using gtk_action_group_add_actions().
|
||
|
||
* app/widgets/gimpcolorpanel.c: override ::get_action_type() so it
|
||
creates GimpActions (which can have a color attached) instead of
|
||
GtkActions. Changed the menu item visibility and color preview
|
||
code accordingly.
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/gimpitemfactory.[ch]: finally removed.
|
||
|
||
* configure.in: added -DGTK_DISABLE_DEPRECATED to CPPFLAGS again.
|
||
|
||
2004-11-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimpoldwidgets.c: #undef GTK_DISABLE_DEPRECATED
|
||
|
||
* libgimpwidgets/gimpunitmenu.h: #include <gtk/gtkoptionmenu.h>
|
||
explicitely and #undef GTK_DISABLE_DEPRECATED only around the
|
||
inclusion if it was defined before.
|
||
|
||
2004-11-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimp/gimpunitcache.h
|
||
* libgimpbase/gimpchecks.h
|
||
* libgimpbase/gimpdatafiles.h
|
||
* libgimpbase/gimplimits.h
|
||
* libgimpbase/gimpmemsize.h
|
||
* libgimpbase/gimputils.h
|
||
* libgimpbase/gimpwin32-io.h
|
||
* libgimpthumb/gimpthumb-enums.h
|
||
* libgimpthumb/gimpthumb-error.h
|
||
* libgimpwidgets/gimppreviewarea.h: added G_BEGIN_DECLS / G_END_DECLS.
|
||
|
||
2004-11-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/ccanalyze.c
|
||
* plug-ins/common/uniteditor.c
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-preview.c
|
||
* plug-ins/ifscompose/ifscompose.c
|
||
* plug-ins/imagemap/imap_misc.c
|
||
* plug-ins/imagemap/imap_selection.c
|
||
* plug-ins/imagemap/imap_toolbar.c
|
||
* plug-ins/imagemap/imap_tools.c
|
||
* plug-ins/print/gimp_color_window.c: stop using deprecated
|
||
functions, added some #undef GTK_DISABLE_DEPRECATED where needed.
|
||
|
||
2004-11-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/module-dialog.c
|
||
* plug-ins/dbbrowser/gimpprocbrowser.c
|
||
* plug-ins/dbbrowser/plugin-browser.c: use
|
||
gtk_tree_model_get_iter_first() instead of the deprecated
|
||
_get_iter_root().
|
||
|
||
* app/display/gimpdisplayshell-callbacks.c: don't include
|
||
"widgets/gimpitemfactory.h".
|
||
|
||
2004-11-03 Øyvind Kolås <pippin@gimp.org>
|
||
|
||
* app/base/gimphistogram.h: %s/historgam/histogram/
|
||
|
||
2004-11-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpdasheditor.c (gimp_dash_editor_finalize): don't
|
||
forget to g_free(editor->segments).
|
||
|
||
2004-11-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpscalecombobox.c
|
||
(gimp_scale_combo_box_mru_remove_last)
|
||
* app/widgets/gimpeditor.c (gimp_editor_add_action_button)
|
||
* app/xcf/xcf-load.c (xcf_load_old_path): plugged some small leaks.
|
||
|
||
2004-11-03 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
|
||
plugged a mem-leak.
|
||
|
||
* app/widgets/gimpviewrendererimagefile.c
|
||
(gimp_view_renderer_imagefile_render): don't leak the pixbuf here.
|
||
|
||
* app/widgets/gimpviewrenderer-frame.c: added a comment.
|
||
|
||
2004-11-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint-funcs/paint-funcs.c (combine_sub_region): applied
|
||
patch from Joao S. O. Bueno which moves assignments into an "else"
|
||
branch and thus optimizes the (common) "if" branch. Did some
|
||
cosmetic cleanups.
|
||
|
||
2004-11-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-interface.c (script_fu_interface):
|
||
don't silently return when there is already a script running but
|
||
show a message instead. Unfortunately introduces two new strings,
|
||
but bugs are bugs. Fixes bug #123882.
|
||
|
||
2004-11-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpimagefile.c (gimp_imagefile_save_thumb): minor
|
||
cleanup.
|
||
|
||
* libgimpthumb/gimpthumb-utils.c (_gimp_thumbs_delete_others): do
|
||
the right thing. Used to do the wrong thing when called with a
|
||
thumbnail size which is not from the GimpThumbSize enum.
|
||
|
||
2004-11-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/image-commands.c (image_new_from_image_cmd_callback):
|
||
call image_new_dialog_set() unconditionally. Fixes bug #157096.
|
||
|
||
2004-11-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/drawable_transform.pdb: factored out the
|
||
"invoke" bodies to two utility functions, getting rid of *tons* of
|
||
duplicated code.
|
||
|
||
* app/pdb/drawable_transform_cmds.c: regenerated (only whitespace
|
||
and comments changed).
|
||
|
||
2004-11-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/drawable_transform.pdb (drawable_*_defaults):
|
||
renamed parameter "interpolation" to "interpolate" as suggested by
|
||
pippin.
|
||
|
||
* app/pdb/drawable_transform_cmds.c
|
||
* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
|
||
|
||
2004-11-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/user-install-dialog.c (user_install_migrate_files):
|
||
don't copy pluginrc* and themerc*.
|
||
|
||
2004-11-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimp/gimpimage.h: one more s/cmap/colormap/.
|
||
|
||
2004-11-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/transform_tools.pdb: deprecated all functions.
|
||
|
||
* app/pdb/transform_tools_cmds.c
|
||
* libgimp/gimptransformtools_pdb.[ch]: regenerated.
|
||
|
||
* plug-ins/common/tiff.c
|
||
* plug-ins/script-fu/scripts/3dTruchet.scm
|
||
* plug-ins/script-fu/scripts/coolmetal-logo.scm
|
||
* plug-ins/script-fu/scripts/image-structure.scm
|
||
* plug-ins/script-fu/scripts/perspective-shadow.scm
|
||
* plug-ins/script-fu/scripts/text-circle.scm
|
||
* plug-ins/script-fu/scripts/truchet.scm: use the new transform API.
|
||
|
||
2004-11-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/drawable_transform.pdb: added _defaults()
|
||
variants (flip_defaults, rotate_defaults, ...) for all transform
|
||
functions which finally call gimp_drawable_transform_affine().
|
||
The _defaults() functions don't take the whole interpolation_type,
|
||
supersample etc. parameter overkill, but only a "interpolation"
|
||
boolean like the old PDB wrappers.
|
||
|
||
* libgimp/gimp.def: changed accordingly.
|
||
|
||
* app/pdb/drawable_transform_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
|
||
|
||
2004-11-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/drawable_transform.pdb: renamed flip() and
|
||
rotate() to flip_simple() and rotate_simple(). Renamed flip_free()
|
||
and rotate_free() to flip() and rotate() (the special cases should
|
||
have a special suffix, not the general ones).
|
||
|
||
* libgimp/gimp.def: changed accordingly.
|
||
|
||
* app/pdb/drawable_transform_cmds.c
|
||
* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
|
||
|
||
2004-11-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/compressor.c (compressors): added missing bzip2
|
||
command lines for Win32.
|
||
|
||
2004-11-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/bmp/bmpread.c
|
||
* plug-ins/bmp/bmpwrite.c
|
||
* plug-ins/common/CEL.c
|
||
* plug-ins/common/animationplay.c
|
||
* plug-ins/common/animoptimize.c
|
||
* plug-ins/common/autostretch_hsv.c
|
||
* plug-ins/common/c_astretch.c
|
||
* plug-ins/common/ccanalyze.c
|
||
* plug-ins/common/color_enhance.c
|
||
* plug-ins/common/film.c
|
||
* plug-ins/common/gee.c
|
||
* plug-ins/common/gee_zoom.c
|
||
* plug-ins/common/gif.c
|
||
* plug-ins/common/gifload.c
|
||
* plug-ins/common/grid.c
|
||
* plug-ins/common/header.c
|
||
* plug-ins/common/mng.c
|
||
* plug-ins/common/normalize.c
|
||
* plug-ins/common/pcx.c
|
||
* plug-ins/common/png.c
|
||
* plug-ins/common/pnm.c
|
||
* plug-ins/common/postscript.c
|
||
* plug-ins/common/psd.c
|
||
* plug-ins/common/psd_save.c
|
||
* plug-ins/common/raw.c
|
||
* plug-ins/common/sunras.c
|
||
* plug-ins/common/tga.c
|
||
* plug-ins/common/tiff.c
|
||
* plug-ins/common/tile.c
|
||
* plug-ins/common/vinvert.c
|
||
* plug-ins/common/winclipboard.c
|
||
* plug-ins/common/winprint.c
|
||
* plug-ins/common/xbm.c
|
||
* plug-ins/common/xpm.c
|
||
* plug-ins/common/xwd.c
|
||
* plug-ins/fits/fits.c
|
||
* plug-ins/gfli/gfli.c
|
||
* plug-ins/imagemap/imap_preview.c
|
||
* plug-ins/print/print.c
|
||
* plug-ins/pygimp/pygimp-image.c
|
||
* plug-ins/winicon/main.c: use the new "colormap" functions
|
||
instead of the deprecated "cmap" ones.
|
||
|
||
2004-11-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
More final API cleanup:
|
||
|
||
* tools/pdbgen/pdb/image.pdb: added gimp_image_set,get_colormap()
|
||
and deprecated set,get_cmap().
|
||
|
||
* libgimpwidgets/gimppreviewarea.[ch]: renamed
|
||
gimp_preview_area_set_cmap() to set_colormap().
|
||
|
||
* libgimp/gimp.def
|
||
* libgimp/gimpdrawablepreview.c
|
||
* libgimp/gimpexport.c
|
||
* libgimp/gimpimage.[ch]
|
||
* libgimpwidgets/gimpwidgets.def: changed accordingly.
|
||
|
||
* app/pdb/image_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* libgimp/gimpimage_pdb.[ch]: regenerated.
|
||
|
||
(undeprecation of plug-ins will follow...)
|
||
|
||
2004-11-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimpcroptool.c (crop_recalc): added "gboolean
|
||
recalc_highlight" and call gimp_display_shell_set_highlight() only
|
||
when it's TRUE. Pass TRUE from all places where the crop outline
|
||
actually changed.
|
||
|
||
(gimp_crop_tool_control): added back the call to crop_recalc() for
|
||
the RESUME case so the outline gets updated on zoom/scroll, but pass
|
||
recalc_highlight = FALSE because it has not changed.
|
||
Fixes bug #157001.
|
||
|
||
2004-11-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/drawable_transform.pdb (flip): renamed
|
||
parameter "center" to "auto_center" and removed
|
||
"transform_direction". Renamed rotate() to rotate_free() and
|
||
added a "gboolean auto_center" parameter. Added new function
|
||
rotate() which takes enum GimpRotationType instead of an
|
||
arbiatrary angle so the flip and rotate APIs are symmetric.
|
||
|
||
* libgimp/gimp.def: added the gimp_drawable_transform_* stuff.
|
||
|
||
* app/pdb/drawable_transform_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
|
||
|
||
2004-11-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/image-scale-dialog.c (image_scale_callback): actually
|
||
use the choosen interpolation type. Fixes bug #157102.
|
||
|
||
2004-11-02 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dobject.c
|
||
* plug-ins/gfig/gfig-dobject.h
|
||
* plug-ins/gfig/gfig-preview.c
|
||
* plug-ins/gfig/gfig-style.h
|
||
* plug-ins/gfig/gfig-types.h
|
||
* plug-ins/gfig/gfig.h: some more cleanups. The current_style bug is
|
||
still there :(
|
||
|
||
2004-11-01 Øyvind Kolås <pippin@gimp.org>
|
||
|
||
* app/xcf/xcf-load.c: applied patch from David Gowers, extra sanity
|
||
checking for the xcf loader, colormaps read from non indexed images
|
||
are discarded. Does not fix bug #134097, but prevents gimp from
|
||
reloading an impossible state.
|
||
|
||
2004-11-01 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpdrawable-transform.[ch]
|
||
(gimp_drawable_transform_flip): renamed "center" to "auto_center".
|
||
|
||
(gimp_drawable_transform_rotate): added missing parameters so it
|
||
can be used for a to-be-added PDB wrapper offering a
|
||
GimpRotationType based rotate API.
|
||
|
||
Both functions: always clip when transforming a whole channel,
|
||
since they must keep their size.
|
||
|
||
(gimp_drawable_transform_affine): actually forward the passed
|
||
"clip_result" to transform_tiles_affine() instead of always FALSE.
|
||
|
||
2004-11-01 Øyvind Kolås <pippin@gimp.org>
|
||
|
||
* app/pdb/color_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* libgimp/gimpcolor_pdb.c
|
||
* libgimp/gimpcolor_pdb.h: regenerated
|
||
* tools/pdbgen/pdb/color.pdb: added levels-stretch to @procs, removed
|
||
metainformation from deprecated levels-auto.
|
||
|
||
2004-11-01 Øyvind Kolås <pippin@gimp.org>
|
||
|
||
* app/actions/drawable-actions.c
|
||
* app/actions/drawable-commands.c
|
||
* app/actions/drawable-commands.h
|
||
* app/base/levels.c
|
||
* app/base/levels.h
|
||
* app/core/gimpdrawable-levels.c
|
||
* app/core/gimpdrawable-levels.h
|
||
* app/pdb/color_cmds.c
|
||
* app/tools/gimplevelstool.c
|
||
* libgimp/gimpcolor_pdb.c
|
||
* menus/image-menu.xml
|
||
* menus/image-menu.xml.in
|
||
* tools/pdbgen/pdb/color.pdb: renamed [drawable-]levels-auto
|
||
to [drawable-]levels-stretch, anticipating other ways to automatically
|
||
determine levels settings, old PDB command maintained, but marked
|
||
as deprecated.
|
||
|
||
2004-11-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
|
||
don't check for file_proc->menu_paths. Our load and save procedure
|
||
don't necessarily register a menu path any longer.
|
||
|
||
* app/plug-in/plug-ins.c: minor cleanup.
|
||
|
||
* app/xcf/xcf.c (xcf_init): no need for adding menu paths for the
|
||
XCF load and save procedures.
|
||
|
||
* tools/pdbgen/pdb/fileops.pdb: fixed outdated documentation.
|
||
|
||
* app/pdb/fileops_cmds.c
|
||
* libgimp/gimpfileops_pdb.c: regenerated.
|
||
|
||
2004-11-01 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/drawable_transform.pdb: added "clip_result" to
|
||
the transform_options_args() utility function and changed all
|
||
wrappers accordingly. Removed "interpolation", "supersample" and
|
||
"recursion_level" args from drawable_transform_flip().
|
||
|
||
* app/pdb/drawable_transform_cmds.c
|
||
* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
|
||
|
||
2004-11-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/tiff.c (query): fixed typo.
|
||
|
||
2004-11-01 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/drawable-actions.c: trailing whitespace.
|
||
|
||
* app/actions/drawable-commands.[ch]: partly revert alphabetical
|
||
ordering. Instead, group them as in drawable-actions.c and order
|
||
by alphabet inside the groups (different ordering in *-actions.c
|
||
and *-commands.c is inconvenient for the usual workflow of editing
|
||
both files at the same time).
|
||
|
||
* app/core/gimpdrawable-levels.h: indentation.
|
||
|
||
2004-11-01 Michael Natterer <mitch@gimp.org>
|
||
|
||
* themes/Small/gtkrc: don't change GtkDialog::button_spacing and
|
||
::action_area_border because it breaks alignment with all other
|
||
dialog spacings or borders (which are hardcoded).
|
||
|
||
2004-11-01 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-types.h: new file to hold the types gfig uses.
|
||
This makes the sources easier to read.
|
||
|
||
* plug-ins/gfig/Makefile.am: added gfig-types.h
|
||
|
||
* plug-ins/gfig/gfig.h: removed some types definitions and put them
|
||
in gfig-types.h and ...
|
||
|
||
* plug-ins/gfig/gfig-dobject.h
|
||
* plug-ins/gfig/gfig-style.h: ...into these files.
|
||
|
||
2004-10-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* Made 2.2-pre1 release.
|
||
|
||
2004-10-31 Simon Budig <simon@gimp.org>
|
||
|
||
* data/images/gimp-splash.png: new splash based on a great photo
|
||
(and pumpkin) by Seth Burgess <sjburges@gimp.org>.
|
||
|
||
2004-10-31 Simon Budig <simon@gimp.org>
|
||
|
||
* plug-ins/common/plasma.c: Fixed handling of 1x1 selection and
|
||
selection out of drawable.
|
||
|
||
2004-10-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gfig/Makefile.am (EXTRA_DIST): removed pix-data.h.
|
||
|
||
2004-10-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* configure.in: changed gimp_version to 2.2-pre1, to match the
|
||
naming scheme of the 2.0 pre-releases.
|
||
|
||
2004-10-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/newsprint.c: removed an unused variable.
|
||
|
||
2004-10-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/user-install-dialog.c: when migrating the user
|
||
settings, tolerate errors and create the tmp directory that was
|
||
explicitely not copied.
|
||
|
||
2004-10-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/config/gimpconfig-utils.c (gimp_config_file_copy): copy the
|
||
file permissions also.
|
||
|
||
* app/dialogs/user-install-dialog.c: added code to migrate user
|
||
settings from ~/.gimp-2.0. It copies all files (except GIMP swap
|
||
files) and all subdirectories (except tmp) with all files. It
|
||
doesn't recurse into subdirectories.
|
||
|
||
2004-10-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/config/gimpguiconfig.c: disabled the image area by default
|
||
to reduce some clutter.
|
||
|
||
2004-10-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/user-install-dialog.c: fixed page logic for migration
|
||
of user settings. Still missing code to actually copy the files.
|
||
|
||
2004-10-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpmemsizeentry.c: don't use camel case in memory
|
||
size identifiers.
|
||
|
||
2004-10-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpimageeditor.c (gimp_image_editor_set_context):
|
||
set the active image. Fixes bug #156942.
|
||
|
||
2004-10-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/user-install-dialog.c: started to work on migration of
|
||
user settings (bug #156636). Not at all functional yet.
|
||
|
||
2004-10-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpwidgets.c: allow for mnemonics in radio
|
||
groups created with gimp_radio_group_new().
|
||
|
||
2004-10-31 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-dobject.c: some more UI improvements.
|
||
|
||
2004-10-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpsizebox.c: added a size entry to edit the
|
||
resolution. This should close bug #151022.
|
||
|
||
2004-10-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/resize-dialog.c: connect the offset controls.
|
||
|
||
2004-10-30 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dobject.c
|
||
* plug-ins/gfig/gfig-style.c: fixed some annoying popup messages at
|
||
the price of a smallish mem-leak that I will fix later.
|
||
|
||
2004-10-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/composite/gimp-composite-generic.c
|
||
(gimp_composite_hue_any_any_any_generic): do nothing if the color
|
||
has no saturation. Patch by Joao S. Bueno. Fixes bug #123296.
|
||
|
||
2004-10-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/image-commands.c (image_scale_cmd_callback): destroy
|
||
the scale dialog when the display is disconnected.
|
||
|
||
* app/dialogs/resize-dialog.c: fixed a couple of bugs related to
|
||
the offset area. Still work in progress.
|
||
|
||
2004-10-30 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/newsprint.c: Moved the preview to the left, as
|
||
suggested by Joao S. O. Bueno.
|
||
|
||
2004-10-30 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-line.c
|
||
* plug-ins/gfig/gfig-line.h
|
||
* plug-ins/gfig/gfig-poly.c
|
||
* plug-ins/gfig/gfig-preview.c
|
||
* plug-ins/gfig/gfig-star.c
|
||
* plug-ins/gfig/gfig-style.c
|
||
* plug-ins/gfig/gfig-style.h: some more cleanups and UI tweaks. Still
|
||
work in progress.
|
||
|
||
* plug-ins/gfig/pix-data.h: removed this empty, unused file.
|
||
|
||
2004-10-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/config/gimpguiconfig.[ch]
|
||
* app/config/gimprc-blurbs.h
|
||
* app/dialogs/preferences-dialog.c
|
||
* app/tools/gimpmoveoptions.[ch]
|
||
* app/tools/gimpmovetool.[ch]: reverted changes for bug #156801.
|
||
Instead added a gimprc option that allows to get the old behaviour
|
||
back.
|
||
|
||
2004-10-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimpmoveoptions.[ch]
|
||
* app/tools/gimpmovetool.[ch]: applied (cleaned up version of) a
|
||
patch from Joao S. O. Bueno that adds a tool-option to restore the
|
||
old Move tool behaviour. Fixes bug #156801.
|
||
|
||
2004-10-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/despeckle.c: applied a patch from Geert Jordaens
|
||
that improves the Despeckle algorithm. See bug #72862.
|
||
|
||
2004-10-29 Kevin Cozens <kcozens@cvs.gimp.org>
|
||
|
||
* plug-ins/script-fu/siod-wrapper.c (init_constants): Updated to
|
||
use convert_string() to change name of constant to Scheme format.
|
||
|
||
2004-10-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* INSTALL
|
||
* NEWS
|
||
* README: updated for 2.2 pre-releases.
|
||
|
||
2004-10-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/grid.c (run): applied patch by Joao S. O. Bueno
|
||
that implements the opacity parameters the way it is documented.
|
||
Fixes bug #156750.
|
||
|
||
2004-10-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/glasstile.c: applied patch from Yeti, updated by
|
||
Kevin Cozens and modified by me. Fixes bug #85261.
|
||
|
||
2004-10-29 Øyvind Kolås <pippin@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/color.pdb: moved body of code from here.
|
||
|
||
* app/core/gimpdrawable-levels.[ch]: to here.
|
||
* app/core/Makefile.am: added gimpdrawable-levels.[ch].
|
||
* app/pdb/color_cmds.c: regenerated.
|
||
|
||
* app/actions/drawable-actions.c
|
||
* app/actions/drawable-commands.[ch]: added drawable-layers-auto
|
||
action.
|
||
|
||
* app/widgets/gimphelp-ids.h: added GIMP_HELP_LAYER_WHITE_BALANCE.
|
||
* app/menus/image-menu.xml.in: added new auto/White Balance action.
|
||
* app/menus/image-menu.xml: regenerated.
|
||
|
||
2004-10-29 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpuimanager.c (gimp_ui_manager_entry_load)
|
||
* app/widgets/gimpclipboard.c (gimp_clipboard_init): only be
|
||
verbose on request.
|
||
|
||
* app/plug-in/plug-in.c (plug_in_close): turned warnings into
|
||
messages and respect gimp->be_verbose.
|
||
|
||
2004-10-29 Øyvind Kolås <pippin@gimp.org>
|
||
|
||
* app/actions/drawable-commands.[ch]
|
||
* app/actions/drawable-actions.[ch]: alphabetized file pending
|
||
addition.
|
||
|
||
2004-10-29 Kevin Cozens <kcozens@cvs.gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/test-sphere.scm: Added notes about
|
||
use of SF-PALETTE.
|
||
|
||
2004-10-29 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/jpeg.c: pass the name in filesystem encoding to
|
||
gimp_image_set_filename(). Fixes bug #153751 for the JPEG plug-in.
|
||
|
||
2004-10-29 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/file/file-utils.c (file_utils_uri_to_utf8_filename): when
|
||
the filename cannot be converted to UTF-8, warn and return the URI
|
||
instead. This is a workaround for the crash described in bug #153751.
|
||
|
||
2004-10-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/dialogs.c (toplevel_entries): added foreign entries
|
||
for the keyboard shortcut and the controller action dialogs.
|
||
|
||
* app/dialogs/preferences-dialog.c
|
||
* app/widgets/gimpcontrollereditor.c: register the dialogs with
|
||
the "toplevel" dialog factory so they remember their size and
|
||
position.
|
||
|
||
2004-10-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/dbbrowser/gimpprocbrowser.c
|
||
* plug-ins/dbbrowser/plugin-browser.c: don't say "1 Procedures" or
|
||
"1 Plug-In Interfaces" but use the singular form instead.
|
||
|
||
2004-10-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/flarefx.c
|
||
* plug-ins/common/nova.c: changed preview cursors to GDK_CROSSHAIR.
|
||
|
||
* plug-ins/common/iwarp.c
|
||
* plug-ins/gflare/gflare.c
|
||
* plug-ins/ifscompose/ifscompose.c: added GDK_CROSSHAIR preview
|
||
cursors. Not quite perfect for IfsCompose (actually needs tool-
|
||
and constext-sensitive cursors) but definitely better than
|
||
before. Fixes bug #90519.
|
||
|
||
2004-10-29 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/edit.pdb: mention gimp_drawable_fill() in the
|
||
docs for gimp_edit_fill().
|
||
|
||
* app/pdb/edit_cmds.c
|
||
* libgimp/gimpedit_pdb.c: regenerated.
|
||
|
||
2004-10-28 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-arc.c
|
||
* plug-ins/gfig/gfig-bezier.c
|
||
* plug-ins/gfig/gfig-bezier.h
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-dialog.h
|
||
* plug-ins/gfig/gfig-dobject.c
|
||
* plug-ins/gfig/gfig-dobject.h
|
||
* plug-ins/gfig/gfig-ellipse.c
|
||
* plug-ins/gfig/gfig-grid.c
|
||
* plug-ins/gfig/gfig-grid.h
|
||
* plug-ins/gfig/gfig.c: small cleanups
|
||
|
||
2004-10-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpdrawablecombobox.c
|
||
* libgimp/gimpimagecombobox.c: changed the API docs to suggest to
|
||
use gimp_int_combo_box_connect() with these widgets. We don't want
|
||
more people to be caught by bug #156659.
|
||
|
||
2004-10-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/grid.c: fixed a long-standing cut'n'paste bug
|
||
which caused the intersection color to be drawn with the wrong
|
||
shade of gray when drawing on a grayscale drawable.
|
||
|
||
2004-10-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/resize-dialog.c: added the offset area back. Still
|
||
work in progress.
|
||
|
||
2004-10-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/helpbrowser/dialog.c: only create a "Document not
|
||
found" error page if the requested URL was a page to load, not a
|
||
supplementary URL like an image. Fixes bug #138275.
|
||
|
||
2004-10-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/bmp/bmp.c
|
||
* plug-ins/common/CEL.c
|
||
* plug-ins/common/aa.c
|
||
* plug-ins/common/compressor.c
|
||
* plug-ins/common/csource.c
|
||
* plug-ins/common/dicom.c
|
||
* plug-ins/common/gbr.c
|
||
* plug-ins/common/gif.c
|
||
* plug-ins/common/gifload.c
|
||
* plug-ins/common/gih.c
|
||
* plug-ins/common/gtm.c
|
||
* plug-ins/common/header.c
|
||
* plug-ins/common/jpeg.c
|
||
* plug-ins/common/mng.c
|
||
* plug-ins/common/pat.c
|
||
* plug-ins/common/pcx.c
|
||
* plug-ins/common/pix.c
|
||
* plug-ins/common/png.c
|
||
* plug-ins/common/pnm.c
|
||
* plug-ins/common/postscript.c
|
||
* plug-ins/common/psd.c
|
||
* plug-ins/common/psd_save.c
|
||
* plug-ins/common/psp.c
|
||
* plug-ins/common/sunras.c
|
||
* plug-ins/common/svg.c
|
||
* plug-ins/common/tga.c
|
||
* plug-ins/common/tiff.c
|
||
* plug-ins/common/url.c
|
||
* plug-ins/common/wmf.c
|
||
* plug-ins/common/xbm.c
|
||
* plug-ins/common/xpm.c
|
||
* plug-ins/common/xwd.c
|
||
* plug-ins/faxg3/faxg3.c
|
||
* plug-ins/fits/fits.c
|
||
* plug-ins/gfli/gfli.c
|
||
* plug-ins/sgi/sgi.c
|
||
* plug-ins/winicon/main.c
|
||
* plug-ins/xjt/xjt.c: removed the calls to gimp_plugin_menu_register()
|
||
from all plug-ins. File plug-ins don't register into a menu any longer.
|
||
|
||
2004-10-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/raw.c (query): do not install an extension for
|
||
the raw plug-in to avoid confusion with the dcraw format.
|
||
|
||
2004-10-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/layers-actions.c (layers_actions_update): do not set
|
||
the "layers-mask-add" action insensitive if there's no alpha channel.
|
||
|
||
* app/actions/layers-commands.c (layers_add_mask_response): add an
|
||
alpha channel if there isn't one already. Fixes bug #156676.
|
||
|
||
2004-10-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-interface.c (script_fu_interface):
|
||
use gimp_int_combo_box_connect() so that the initial selection
|
||
causes the "changed" callback to be run. Should fix bug #156659.
|
||
|
||
2004-10-28 Øyvind Kolås <pippin@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-preview.c: Improve preview accuracy of
|
||
perspective transform, by subdiving into a 5x5 grid.
|
||
|
||
Fixes bug #152222.
|
||
|
||
2004-10-27 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/display/gimpdisplayshell-preview.c: Really fixed all cases
|
||
of the perspective tool preview breaking with certain orientations by
|
||
using triangles instead of quads.
|
||
|
||
2004-10-27 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/display/gimpdisplayshell-preview.c: Hopefully fixed all cases
|
||
of the perspective tool preview breaking with certain orientations.
|
||
|
||
2004-10-27 Manish Singh <yosh@gimp.org>
|
||
|
||
* tools/pdbgen/enumcode.pl: Don't declare $first twice.
|
||
|
||
* libgimp/Makefile.am: Be sure to distribute gimpenums.c.tail.
|
||
|
||
* libgimp/gimpenums.c.tail: Added into CVS.
|
||
|
||
2004-10-27 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-bezier.[ch]: added a notebook page for the
|
||
bezier tool options instead of yet another popup window.
|
||
|
||
* plug-ins/gfig/gfig-dialog.c: modified accordingly and HIGed a bit.
|
||
|
||
2004-10-27 Øyvind Kolås <pippin@gimp.org>
|
||
|
||
* app/core/gimpdrawable-transform.c: made the fixed point used in
|
||
supersampling configurable (in source) and changed from 15.16 to
|
||
21.10 fixed point.
|
||
|
||
Fixes bug #128594 for drawables less than 2G wide.
|
||
|
||
2004-10-27 Michael Schumacher <schumaml@gmx.de>
|
||
|
||
* app/widgets/gimpwidgets-utils.c: fixed a typo in
|
||
#include "libgimpbase/gimpwin32-io.h"
|
||
|
||
2004-10-27 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.[ch]
|
||
* plug-ins/gfig/gfig-poly.[ch]
|
||
* plug-ins/gfig/gfig-spiral.[ch]
|
||
* plug-ins/gfig/gfig-star.[ch]
|
||
* plug-ins/gfig/gfig.h: first step of moving all the hidden popup
|
||
dialogs for the tool options in a GtkNotebook showing the options
|
||
within one page for each tool.
|
||
|
||
2004-10-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/enumcode.pl: removed trailing commmas from output.
|
||
|
||
2004-10-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/enumcode.pl: fixed loop control in
|
||
_gimp_enums_init(). This caused all plug-ins to crash immidiately.
|
||
You will need to make sure that libgimp/gimpenums.c.tail is
|
||
recreated and appended to libgimp/gimpenums.c
|
||
|
||
2004-10-27 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimp-transform-utils.[ch]. switch from x1,y1,x2,y2
|
||
bounding boxes to x,y,width,height ones. Added
|
||
gimp_transform_matrix_flip_free(). Renamed some parameters to be
|
||
consistent with others. Some internal cleanup.
|
||
|
||
* app/tools/gimpperspectivetool.c
|
||
* app/tools/gimpscaletool.c
|
||
* app/tools/gimpsheartool.c
|
||
* tools/pdbgen/pdb/drawable_transform.pdb
|
||
* tools/pdbgen/pdb/transform_tools.pdb: changed accordingly.
|
||
|
||
* tools/pdbgen/pdb/drawable_transform.pdb
|
||
* tools/pdbgen/pdb/transform_tools.pdb: guard all transform
|
||
wrappers with if(gimp_drawable_mask_intersect(...)), also the
|
||
ones which don't need the returned bounding box.
|
||
|
||
* tools/pdbgen/pdb/drawable_transform.pdb: renamed some parameters
|
||
and added gimp_drawable_transform_matrix() which takes the 9
|
||
coefficients of a 3x3 matrix for ultimate flexibility ;)
|
||
|
||
* app/pdb/drawable_transform_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* app/pdb/transform_tools_cmds.c
|
||
* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
|
||
|
||
2004-10-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/dockable-actions.c (dockable_toggle_actions): changed
|
||
menu label from "Show Image Menu" to "Show Image Selection".
|
||
|
||
* app/widgets/gimpsizebox.c: unmarked a string for translation.
|
||
|
||
* app/dialogs/scale-dialog.c: added back the message when scaling
|
||
an indexed image.
|
||
|
||
2004-10-27 DindinX <dindinx@gimp.org>
|
||
|
||
* libgimp/gimpaspectpreview.c: really use the second parameter of
|
||
gimp_aspect_preview_new (), so plug-ins can now really remember the
|
||
state of the preview between invocations.
|
||
|
||
* libgimpwidgets/gimpscrolledpreview.c: fix a little typo
|
||
|
||
* plug-ins/common/channel_mixer.c: fix a warning by using TRUE for a
|
||
boolean value (initial state of the preview) instead of a weird NULL.
|
||
|
||
2004-10-27 Michael Natterer <mitch@gimp.org>
|
||
|
||
* modules/controller_linux_input.c
|
||
* modules/controller_midi.c: don't g_free(error) but
|
||
g_clear_error(&error) the GError.
|
||
|
||
2004-10-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/resize-dialog.[ch]: started to redo the Resize
|
||
dialog in the style of the new Scale dialog. Only halfway done but
|
||
at least the new API is there.
|
||
|
||
* app/actions/image-commands.c
|
||
* app/actions/layers-commands.c: changed accordingly.
|
||
|
||
* app/dialogs/image-scale-dialog.c: cosmetics.
|
||
|
||
2004-10-27 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/gfig/*[ch]: preliminary cleanups: removed all trailing
|
||
spaces.
|
||
|
||
2004-10-26 Manish Singh <yosh@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/drawable_transform.pdb: removed abuse of init,
|
||
called pdb_misc in all procedures.
|
||
|
||
* app/pdb/drawable_transform_cmds.c
|
||
* libgimp/gimpdrawabletransform_pdb.c: regenerated.
|
||
|
||
2004-10-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/Makefile.am (PDB_WRAPPERS_H, PDB_WRAPPERS_C): added new
|
||
files gimpdrawabletranform_pdb.[ch].
|
||
|
||
2004-10-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/Makefile.am
|
||
* app/dialogs/image-scale-dialog.[ch]: a wrapper around the scale
|
||
dialog that takes care of verifying the user input and optionally
|
||
asking for confirmation. Most of this moved out of image-commands.c.
|
||
|
||
* app/actions/image-commands.c: use the new image scale dialog
|
||
even though it doesn't allow to edit the resolution yet. That's a
|
||
temporary regression that will get fixed soon.
|
||
|
||
* app/actions/layers-commands.c: cosmetics.
|
||
|
||
* app/dialogs/scale-dialog.c (scale_dialog_reset): also reset the
|
||
resolution.
|
||
|
||
* app/widgets/gimpsizebox.c: fixed cut'n'paste error.
|
||
|
||
2004-10-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpsizebox.[ch]: added a resolution label similar
|
||
to one in the template editor. Prepared for editable resolution,
|
||
work in progress...
|
||
|
||
* app/dialogs/scale-dialog.[ch]: added resolution and resolution
|
||
unit parameters to ScaleDialogCallback.
|
||
|
||
* app/actions/layers-commands.c: changed accordingly.
|
||
|
||
2004-10-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimptemplateeditor.c: commented out the memory size
|
||
label. The visual clutter of it's bold appearance was IMO not
|
||
appropriate. I think the dialog is better without it.
|
||
|
||
* app/widgets/gimpsizebox.c: added a pixel size label as in the
|
||
Image New dialog.
|
||
|
||
2004-10-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/enumcode.pl: added gtk-doc comment for
|
||
gimp_enums_get_type_names().
|
||
|
||
2004-10-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/retinex.c: applied patch by Geert Jordaens that
|
||
lets Retinex deal with RGBA drawables. Closes bug #135594 again.
|
||
|
||
2004-10-26 Sven Neumann <sven@gimp.org>
|
||
|
||
Added new drawable transform API to the PDB. Largely based on
|
||
patches from Joao S. O. Bueno. Fixes bug #137053.
|
||
|
||
* app/core/gimpdrawable-transform.[ch]: added missing parameters
|
||
to gimp_drawable_transform_flip().
|
||
|
||
* tools/pdbgen/pdb/transform_tools.pdb: changed accordinly.
|
||
|
||
* app/base/base-enums.h
|
||
* app/core/core-enums.h: removed pdp-skip for GimpInterpolationType
|
||
and GimpTransformDirection enums.
|
||
|
||
* libgimp/gimpenums.h
|
||
* plug-ins/pygimp/gimpenums.py
|
||
* tools/pdbgen/enums.pl
|
||
* tools/pdbgen/groups.pl: regenerated.
|
||
|
||
* tools/pdbgen/Makefile.am
|
||
* tools/pdbgen/pdb/drawable_transform.pdb: added new file defining
|
||
the new PDB calls.
|
||
|
||
* app/pdb/Makefile.am
|
||
* app/pdb/drawable_transform_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* app/pdb/transform_tools_cmds.c
|
||
* libgimp/gimp_pdb.h
|
||
* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
|
||
|
||
2004-10-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* modules/controller_linux_input.c
|
||
* modules/controller_midi.c: don't enter an infinite blocking loop
|
||
when the user selects an input file that can be opened, but not
|
||
read (like a directory).
|
||
|
||
2004-10-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpactionview.[ch] (gimp_action_view_new): added
|
||
parameter "const gchar *select_action" and preselect the passed
|
||
action if non-NULL. Made the column enum public to users of this
|
||
widget can get data from its tree store.
|
||
|
||
* app/dialogs/preferences-dialog.c (prefs_keyboard_shortcuts_dialog):
|
||
pass NULL because we don't want a preselected action here.
|
||
|
||
* app/widgets/gimpcontrollereditor.[ch]: added "Edit" and "Delete"
|
||
buttons to change the event -> action mapping. Implement a action
|
||
chooser dialog using GimpActionView. Fixes bug #106920.
|
||
|
||
2004-10-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/channels-commands.c
|
||
* app/core/gimpchannel-select.c
|
||
* app/core/gimpimagefile.c
|
||
* app/core/gimpundo.c
|
||
* app/widgets/gimpcomponenteditor.c: use the new enum utility
|
||
functions from libgimpbase instead of accessing enum_value->value_name.
|
||
|
||
2004-10-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/quit-dialog.c (quit_dialog_container_changed): when
|
||
changing the button's label to "Quit", also make it the default
|
||
action.
|
||
|
||
2004-10-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpcontrollereditor.[ch]: new widget built from
|
||
preliminary code from the prefs dialog. Prerequisite for finally
|
||
fixing bug #106920.
|
||
|
||
* app/dialogs/preferences-dialog.c: use the new widget.
|
||
|
||
2004-10-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/retinex.c: cleaned up the GUI and GIMP-specific
|
||
code a bit. Use gimp_drawable_mask_intersect().
|
||
|
||
2004-10-25 Manish Singh <yosh@gimp.org>
|
||
|
||
* tools/pdbgen/enumcode.pl: Use $1 instead of deprecated \1 for
|
||
regexp group.
|
||
|
||
2004-10-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/script-fu/siod-wrapper.c (marshall_proc_db_call):
|
||
my last change removed the sanity check for array_length >= 0.
|
||
Put it back.
|
||
|
||
2004-10-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpbase/gimpbase.def: updated.
|
||
|
||
2004-10-25 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/retinex.c: added this new plug-in.
|
||
Addresses bug #135594
|
||
|
||
* plug-ins/common/plugin-defs.pl: modified accordingly.
|
||
|
||
* plug-ins/common/.cvsignore
|
||
* plug-ins/common/Makefile.am: regenerated.
|
||
|
||
* plug-ins/gfig/gfig-arc.c
|
||
* plug-ins/gfig/gfig-arc.h
|
||
* plug-ins/gfig/gfig-circle.c
|
||
* plug-ins/gfig/gfig-circle.h
|
||
* plug-ins/gfig/gfig-dialog.c: smallish style cleanups
|
||
|
||
2004-10-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/script-fu/siod-wrapper.c (marshall_proc_db_call):
|
||
silently accept arrays which are longer than specified. Nothing
|
||
bad can happen and it's common practice to resize arrays in fixed
|
||
size chunks so avoid frequent resizing. Fixes bug #155359.
|
||
|
||
2004-10-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/script-fu/siod-wrapper.c (init_constants): removed
|
||
debugging output i forgot.
|
||
|
||
2004-10-25 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/quit-dialog.c: change the action button's label to
|
||
"Quit" if there are no images with unsaved changes.
|
||
|
||
2004-10-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpbase/gimpbaseenums.[ch]: register some missing enums.
|
||
|
||
* tools/pdbgen/enumcode.pl: removed code to generate
|
||
plug-ins/script-fu/script-fu-constants.c, generate code to
|
||
explicitely initialize and query all of libgimp*'s enums
|
||
and write it to libgimp/gimpenums.c.tail
|
||
|
||
* libgimp/gimpenums.h: regenerated.
|
||
|
||
* libgimp/Makefile.am: append gimpenums.c.tail to gimpenums.c
|
||
|
||
* libgimp/gimp.c (gimp_main): call g_type_init() and
|
||
_gimp_enums_init().
|
||
|
||
* libgimp/gimp.def: added gimp_enums_get_type_names().
|
||
|
||
* plug-ins/script-fu/Makefile.am
|
||
* plug-ins/script-fu/script-fu-constants.[ch]: removed these files.
|
||
|
||
* plug-ins/script-fu/siod-wrapper.c: dynamically register all
|
||
constants using gimp_enums_get_type_names() and introspection.
|
||
Also register the built-in unit types.
|
||
|
||
* plug-ins/script-fu/script-fu.c: changed accordingly.
|
||
|
||
2004-10-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
Don't store human readable and translatable enum/flag strings in
|
||
GEnumValue's and GTypeValue's fields but attach them to their
|
||
GType using separate structs and utility functions:
|
||
|
||
* tools/gimp-mkenums: added params and perl voodoo to support
|
||
generating a second array of values, which is used by the
|
||
Makefiles below to create and register arrays of value
|
||
descriptions.
|
||
|
||
* libgimpbase/gimpbasetypes.[ch]: added API to attach/retreive
|
||
arrays of translatable strings to/from enum and flags types. Added
|
||
structs GimpEnumDesc and GimpFlagsDesc for that purpose.
|
||
|
||
* libgimpbase/gimputils.[ch]: changed existing enum utility
|
||
functions, added new ones and added a symmetric API for flags.
|
||
|
||
* app/base/Makefile.am
|
||
* app/core/Makefile.am
|
||
* app/display/Makefile.am
|
||
* app/paint/Makefile.am
|
||
* app/text/Makefile.am
|
||
* app/tools/Makefile.am
|
||
* app/widgets/Makefile.am
|
||
* libgimp/Makefile.am
|
||
* libgimpbase/Makefile.am: changed *-enums.c generation rules
|
||
accordingly.
|
||
|
||
* app/base/base-enums.c
|
||
* app/core/core-enums.c
|
||
* app/display/display-enums.c
|
||
* app/paint/paint-enums.c
|
||
* app/text/text-enums.c
|
||
* app/tools/tools-enums.c
|
||
* app/widgets/widgets-enums.c
|
||
* libgimpbase/gimpbaseenums.c: regenerated.
|
||
|
||
* app/widgets/gimpenumstore.c
|
||
* app/widgets/gimpenumwidgets.c
|
||
* app/widgets/gimptemplateeditor.c
|
||
* libgimpwidgets/gimppreviewarea.c: follow the enum utility
|
||
function API changes.
|
||
|
||
2004-10-25 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/imagemap/imap_cmd_gimp_guides.c
|
||
* plug-ins/imagemap/imap_edit_area_info.c
|
||
* plug-ins/imagemap/imap_main.c
|
||
* plug-ins/imagemap/imap_menu.[ch]
|
||
* plug-ins/imagemap/imap_menu_funcs.[ch]
|
||
* plug-ins/imagemap/imap_misc.c
|
||
* plug-ins/imagemap/imap_settings.c
|
||
* plug-ins/imagemap/imap_source.c: added a menu entry for Help.
|
||
Did more minor layout adjustments for HIG compliance.
|
||
|
||
2004-10-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpobject.c: #include "libgimpbase/gimpbase.h", not
|
||
just gimputils.h
|
||
|
||
2004-10-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* menus/toolbox-menu.xml.in: commented out the "Debug" submenu.
|
||
Should do this via an xsltproc --param actually...
|
||
|
||
2004-10-25 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/newsprint.c: removed debugging g_print and
|
||
remove my memory fix, since it was buggy and shouldn't be done.
|
||
My fix just broke this plug-in (reported by Joao S. O. Bueno
|
||
Calligaris)
|
||
|
||
2004-10-25 Simon Budig <simon@gimp.org>
|
||
|
||
* app/tools/gimpvectortool.c: Switch to design mode when
|
||
Escape gets pressed. Untabbified.
|
||
|
||
2004-10-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/gradient-editor-commands.c
|
||
* app/display/gimpdisplayshell-preview.c: irrelevant coding style
|
||
and spacing cleanups.
|
||
|
||
* app/widgets/gimpimageeditor.c: removed utility function
|
||
gimp_image_editor_context_changed() and connect
|
||
gimp_image_editor_set_image() directly using
|
||
g_signal_connect_swapped().
|
||
|
||
2004-10-25 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/imagemap/imap_circle.c
|
||
* plug-ins/imagemap/imap_cmd_gimp_guides.c
|
||
* plug-ins/imagemap/imap_cmd_guides.c
|
||
* plug-ins/imagemap/imap_default_dialog.[ch]
|
||
* plug-ins/imagemap/imap_edit_area_info.c
|
||
* plug-ins/imagemap/imap_grid.c
|
||
* plug-ins/imagemap/imap_main.c
|
||
* plug-ins/imagemap/imap_misc.c
|
||
* plug-ins/imagemap/imap_polygon.c
|
||
* plug-ins/imagemap/imap_preferences.c
|
||
* plug-ins/imagemap/imap_rectangle.c
|
||
* plug-ins/imagemap/imap_selection.c
|
||
* plug-ins/imagemap/imap_source.c
|
||
* plug-ins/imagemap/imap_toolbar.c
|
||
* plug-ins/imagemap/imap_tools.c: reviewed for HIG
|
||
compliance. Various other minor fixes. Closes bug #150004.
|
||
|
||
2004-10-25 Kevin Cozens <kcozens@cvs.gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/test-sphere.scm: Added parameter
|
||
missing from argument list.
|
||
|
||
2004-10-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/enumcode.pl
|
||
* libgimp/Makefile.am: register all enums in libgimp/gimpenums.h
|
||
with the type system.
|
||
|
||
* libgimp/gimpenums.h: regenerated.
|
||
|
||
* libgimp/gimp.def: updated.
|
||
|
||
2004-10-25 Sven Neumann <sven@gimp.org>
|
||
|
||
* configure.in: gimp_user_version should be 2.2.
|
||
|
||
* libgimpmodule/Makefile.am (AM_CPPFLAGS): cleanup.
|
||
|
||
2004-10-25 Sven Neumann <sven@gimp.org>
|
||
|
||
* configure.in:
|
||
* app/Makefile.am
|
||
* tools/Makefile.am: bumped version to 2.2.0-pre1, set app version
|
||
to 2.2, reset other versions to 2.0. Changed library versioning so
|
||
we install with the same soname as gimp-2.0 again.
|
||
|
||
2004-10-25 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpimagefile.c (gimp_imagefile_get_desc_string): say
|
||
"Click to create preview" if no preview is available.
|
||
|
||
2004-10-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpwidgets-utils.[ch]: added gimp_text_buffer_save()
|
||
which saves a GtkTextBuffer's contents to a file.
|
||
|
||
* app/widgets/gimperrorconsole.c: use
|
||
gimp_editor_add_action_button() and removed all "clicked"
|
||
callbacks, including all file saving code.
|
||
|
||
* app/actions/error-console-actions.c
|
||
* app/actions/error-console-commands.[ch]: added the code removed
|
||
above to the action callbacks. Use gimp_text_buffer_save().
|
||
|
||
2004-10-24 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpgradienteditor.[ch]
|
||
* app/widgets/gimppaletteeditor.[ch]: added public APIs for
|
||
zooming the editors. Use gimp_editor_add_action_button() to create
|
||
all buttons. Removed all button callbacks and all duplicated
|
||
button sensitivity logic.
|
||
|
||
* app/widgets/gimpdataeditor.c (gimp_data_editor_set_data): update
|
||
the editor's UI manager if it exists.
|
||
|
||
* app/actions/gradient-editor-actions.c
|
||
* app/actions/gradient-editor-commands.[ch]: added zoom actions
|
||
and callback and call gimp_gradient_editor_zoom(). Fixed
|
||
gradient_editor_actions_update() to actually set all items'
|
||
sensitivity (it was possible to modify read-only gradients and
|
||
even to crash GIMP).
|
||
|
||
* app/actions/palette-editor-actions.c
|
||
* app/actions/palette-editor-commands.[ch]: changed "new" and
|
||
"zoom" actions to actually do their job instead of calling
|
||
gtk_button_clicked(editor->foo_button).
|
||
|
||
2004-10-24 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcolormapeditor.c: removed the "Edit Color"
|
||
dialog callbacks and use gimp_editor_add_action_button() for
|
||
the edit button. Removed button sensitivity logic. Hide the
|
||
color dialog when the image's mode changes.
|
||
|
||
* app/actions/colormap-editor-actions.c: added missing tooltip
|
||
for the edit action.
|
||
|
||
* app/actions/colormap-editor-commands.c: implement the dialog
|
||
here.
|
||
|
||
2004-10-24 DindinX <dindinx@gimp.org>
|
||
|
||
* app/core/gimpdrawable-desaturate.c: only return early if there's
|
||
nothing to desaturate.
|
||
|
||
2004-10-24 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/vectors-commands.c: don't leak the filenames of the
|
||
import and export dialogs.
|
||
|
||
2004-10-24 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/Makefile.am
|
||
* app/dialogs/vectors-export-dialog.[ch]
|
||
* app/dialogs/vectors-import-dialog.[ch]: new files.
|
||
|
||
* app/actions/vectors-commands.c: use the new dialogs and remember
|
||
their last values.
|
||
|
||
2004-10-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/vectors-commands.c: added missing controls to the
|
||
path import and export dialogs.
|
||
|
||
2004-10-23 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/newsprint.c: cleaned it up, fixed a (documented)
|
||
memory leak and the weird behaviour of the resolution scales.
|
||
|
||
2004-10-23 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/newsprint.c: added a preview.
|
||
|
||
2004-10-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimp/gimpaspectpreview.h
|
||
* libgimp/gimpdrawablepreview.h
|
||
* libgimp/gimpprogressbar.h
|
||
* libgimpwidgets/gimpcellrenderercolor.h
|
||
* libgimpwidgets/gimpcellrenderertoggle.h
|
||
* libgimpwidgets/gimpframe.h
|
||
* libgimpwidgets/gimpintcombobox.h
|
||
* libgimpwidgets/gimpintstore.h
|
||
* libgimpwidgets/gimppreview.h
|
||
* libgimpwidgets/gimppreviewarea.h
|
||
* libgimpwidgets/gimpscrolledpreview.h: added padding to all class
|
||
structs which have been added since 2.0.
|
||
|
||
2004-10-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/file-commands.c (file_save_cmd_callback): don't
|
||
g_return_if_fail() if there is no active drawable, just silently
|
||
return.
|
||
|
||
* app/actions/image-commands.c: remember the last merge_type of
|
||
the "Merge Visible Layers" dialog.
|
||
|
||
* app/actions/layers-commands.c: remeber the last values of the
|
||
"Add Layer Mask" dialog.
|
||
|
||
* app/actions/select-commands.c: renamed a bunch of static
|
||
variables to be consistent with other variables used to remember
|
||
dialog values.
|
||
|
||
* app/actions/view-commands.c (view_fullscreen_cmd_callback): it's
|
||
useless to update the "view-fullscreen" actions here because the
|
||
"fullscreen" state of the shell changes asynchronously
|
||
|
||
2004-10-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/image-merge-layers-dialog.c
|
||
* app/dialogs/layer-add-mask-dialog.c: made them not resizable.
|
||
|
||
* app/dialogs/convert-dialog.c
|
||
* app/dialogs/offset-dialog.c: renamed ugly variables.
|
||
|
||
* app/dialogs/image-new-dialog.c
|
||
* app/dialogs/stroke-dialog.c: irrelevant pedantic code reordering.
|
||
|
||
2004-10-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/Makefile.am
|
||
* app/dialogs/image-merge-layers-dialog.[ch]: one more dialog split
|
||
out of actions/.
|
||
|
||
* app/actions/image-commands.c: removed it here. Some cleanup.
|
||
|
||
2004-10-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpthumb/gimpthumb-utils.[ch]
|
||
* libgimpthumb/gimpthumbnail.[ch]
|
||
* libgimpthumb/gimpthumb.def: added missing API, mainly for deleting
|
||
thumbnails.
|
||
|
||
* app/core/gimpimagefile.[ch]: when saving a thumbnail, delete a
|
||
failure thumbnail if one exists. Unless the thumbnail was created
|
||
explicitely, remove all other thumbnails for this image.
|
||
|
||
* app/actions/documents-commands.c: changed accordingly.
|
||
|
||
* app/file/file-open.c: only save a thumbnail if there isn't a
|
||
valid thumbnail already.
|
||
|
||
* app/widgets/gimpthumbbox.c: before attempting to create a new
|
||
thumbnail, check if there's an uptodate failure thumbnail.
|
||
|
||
2004-10-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/Makefile.am
|
||
* app/dialogs/layer-add-mask-dialog.[ch]: one more dialog split
|
||
out of actions/.
|
||
|
||
* app/actions/layers-commands.c: removed it here. Some cleanup.
|
||
|
||
2004-10-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* autogen.sh: don't tell nonsense by printing "I am going to run
|
||
./configure with no arguments", because we always pass at least
|
||
--enable-maintainer-mode. Instead, simply always print all
|
||
arguments. Also removed --copy from the calls to glib-gettextize
|
||
and intltoolize.
|
||
|
||
2004-10-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimpstock.c: added labels ("_Stroke") to the
|
||
SLEECTION_STROKE and PATH_STROKE stock items so they can be used
|
||
in action areas.
|
||
|
||
* app/widgets/gimpstrokeeditor.c: changed mnemonic to no clash
|
||
with "_Stroke" and reordered some code.
|
||
|
||
* app/dialogs/stroke-dialog.[ch]: use the passed stock_id instead
|
||
of GTK_STOCK_OK. Added parameters to specify the dialog's title
|
||
so it doesn't say "Stroke Options".
|
||
|
||
* app/actions/select-commands.c
|
||
* app/actions/vectors-commands.c
|
||
* app/tools/gimpvectortool.c: pass "Stroke Selection" and "Stroke
|
||
Path" as dialog titles.
|
||
|
||
2004-10-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
When there are variants of actions with and without dialog, let
|
||
the dialog-less actions try to use the values from the last dialog
|
||
invocation:
|
||
|
||
* app/actions/channels-actions.c
|
||
* app/actions/channels-commands.[ch]
|
||
* app/actions/layers-actions.c
|
||
* app/actions/layers-commands.[ch]
|
||
* app/actions/vectors-actions.c
|
||
* app/actions/vectors-commands.[ch]: renamed the foo-new-defaults
|
||
actions to foo-new-last-values and use the last values entered in
|
||
the dialogs.
|
||
|
||
* app/widgets/gimpchanneltreeview.c
|
||
* app/widgets/gimpitemtreeview.c
|
||
* app/widgets/gimplayertreeview.c
|
||
* app/widgets/gimpvectorstreeview.c: changed accordingly. Show
|
||
the dialog on clicking "New" and call the last-values action on
|
||
<shift>+click.
|
||
|
||
* app/actions/select-actions.c
|
||
* app/actions/vectors-commands.c: renamed the foo-stroke-last-vals
|
||
to -last-values.
|
||
|
||
* app/widgets/gimpselectioneditor.c
|
||
* app/widgets/gimpvectorstreeview.c: stroke with last values on
|
||
<shift> clicking the stroke buttons.
|
||
|
||
2004-10-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpthumb/gimpthumbnail.c (gimp_thumbnail_save): save to a
|
||
temporary file to avoid problems with concurrent thumbnail
|
||
creation.
|
||
|
||
2004-10-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/Makefile.am
|
||
* app/dialogs/layer-options-dialog.[ch]: the new/edit layer dialog.
|
||
|
||
* app/actions/layers-commands.c: use it here.
|
||
|
||
2004-10-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimpimagemaptool.[ch]
|
||
* app/tools/gimpcurvestool.c
|
||
* app/tools/gimplevelstool.c: allow to Shift-click the Load and
|
||
Save buttons to skip the file chooser dialog and reuse the last
|
||
used filename. Fixes bug #75558.
|
||
|
||
2004-10-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/Makefile.am
|
||
* app/dialogs/template-options-dialog.[ch]: the new/edit template
|
||
dialog.
|
||
|
||
* app/actions/templates-commands.c: removed the code here and use
|
||
template_options_dialog_new(). Removed utility functions. Some
|
||
cleanup.
|
||
|
||
2004-10-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpeditor.c (gimp_editor_ensure_button_box): make
|
||
sure the button_box is always interted at the very bottom of the
|
||
editor.
|
||
|
||
* app/widgets/gimpviewabledialog.c: changed the "description"
|
||
property from CONSTRUCT_ONLY to CONSTRUCT.
|
||
|
||
* app/widgets/gimpcolormapeditor.c: show the index of the edited
|
||
color in the color dialog and use the correct icon. Replaced label
|
||
"Hex triplet" by "HTML notation" to be consistent with the color
|
||
dialog. Removed wrong 2 pixel border around the table below the
|
||
preview.
|
||
|
||
2004-10-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/wmf.c: fixed non-interactive call with default
|
||
values.
|
||
|
||
2004-10-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/colormap-editor-actions.c
|
||
* app/actions/dialogs-actions.c
|
||
* app/core/gimpimage-colormap.c
|
||
* app/dialogs/convert-dialog.c
|
||
* app/dialogs/dialogs.c
|
||
* app/widgets/gimpcolormapeditor.c: use the term "Colormap"
|
||
instead of "Indexed Palette". Fixes bug #155829.
|
||
|
||
2004-10-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/wmf.c: applied a patch by Karine Proot that adds
|
||
a preview to the load dialog and a similar UI as the SVG loader.
|
||
Fixes bug #133519 and bug #133521.
|
||
|
||
2004-10-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/core-enums.[ch]: added new enum GimpStrokeMethod which
|
||
can be one of { LIBART, PAINT_CORE }.
|
||
|
||
* app/core/Makefile.am
|
||
* app/core/core-types.h
|
||
* app/core/gimpstrokedesc.[ch]: new object which encapsulates
|
||
the params and setup logic for the different stroke methods.
|
||
|
||
* app/core/gimpitem.[ch]: use it in GimpItem::stroke() and
|
||
in the gimp_item_stroke() wrapper.
|
||
|
||
* app/core/gimpchannel.c (gimp_channel_stroke)
|
||
* app/core/gimpselection.c (gimp_selection_stroke)
|
||
* app/vectors/gimpvectors.c (gimp_vectors_stroke): changed accprdingly.
|
||
|
||
* app/actions/select-commands.c
|
||
* app/actions/vectors-commands.c
|
||
* app/dialogs/stroke-dialog.c
|
||
* tools/pdbgen/pdb/edit.pdb
|
||
* tools/pdbgen/pdb/paths.pdb: use GimpStrokeDesc. Simplifies the
|
||
code quite a bit.
|
||
|
||
* app/pdb/edit_cmds.c
|
||
* app/pdb/paths_cmds.c: regenerated.
|
||
|
||
2004-10-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimppropwidgets.c: remember the param_spec with each
|
||
radio button instead of with the box/frame around them.
|
||
|
||
2004-10-21 Kevin Cozens <kcozens@cvs.gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu.c: Removed _() tag from two strings
|
||
that should not have been marked for translation.
|
||
|
||
2004-10-21 Kevin Cozens <kcozens@cvs.gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts-fu.c: Fixed spelling error.
|
||
|
||
2004-10-21 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/select-actions.c
|
||
* app/actions/select-commands.[ch]
|
||
* app/actions/vectors-actions.c
|
||
* app/actions/vectors-commands.[ch]: added actions and callbacks
|
||
to stroke with the last values used without showing the stroke
|
||
dialog. The actions have no menu entries but can be called via
|
||
shortcuts. Fixes bug #135746.
|
||
|
||
(Disclaimer: the uglyness of the callbacks shows the need for a
|
||
stroke API overhaul).
|
||
|
||
2004-10-20 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpdrawable-stroke.c
|
||
(gimp_drawable_stroke_scan_convert): Replacing the call to
|
||
gimp_channel_is_empty() by a simple gimp_drawable_mask_intersect()
|
||
was wrong because gimp_channel_is_empty() makes sure that the
|
||
selection doesn't mask itself while being stroked.
|
||
|
||
2004-10-20 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/raw.c: ported to GimpPreviewArea.
|
||
|
||
2004-10-20 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/raw.c: new plug-in from Tim Copperfield, made
|
||
work with the GIMP 2.1 API by Philipp Gühring, then heavily
|
||
cleaned up and undeprecated by myself. Fixes bug #144943.
|
||
|
||
(still uses GtkPreview, but i wanted a sane state in cvs to diff
|
||
against before replacing it)
|
||
|
||
* plug-ins/common/plugin-defs.pl: changed accordingly.
|
||
|
||
* plug-ins/common/Makefile.am: regenerated.
|
||
|
||
2004-10-20 Michael Natterer <mitch@gimp.org>
|
||
|
||
Fixed bug #155733 for libgimp:
|
||
|
||
* tools/pdbgen/pdb/drawable.pdb: export drawable_mask_intersect()
|
||
to the PDB and improved documentation for drawable_mask_bounds().
|
||
|
||
* app/pdb/drawable_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* libgimp/gimpdrawable_pdb.[ch]: regenerated.
|
||
|
||
* libgimp/gimp.def: changed accordingly.
|
||
|
||
2004-10-20 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpdrawable.[ch]: added gimp_drawable_mask_intersect()
|
||
which returns the same bounding box as gimp_drawable_mask_bounds(),
|
||
but returns TRUE only if there is a non-empty intersection between
|
||
the drawable and the selection, or no selection at all. It also
|
||
returns the intersection as x,y,width,height instead of the
|
||
eeky x1,y1,x2,y2.
|
||
|
||
* app/core/gimp-edit.c
|
||
* app/core/gimpdrawable-blend.c
|
||
* app/core/gimpdrawable-bucket-fill.c
|
||
* app/core/gimpdrawable-desaturate.c
|
||
* app/core/gimpdrawable-equalize.c
|
||
* app/core/gimpdrawable-histogram.c
|
||
* app/core/gimpdrawable-invert.c
|
||
* app/core/gimpdrawable-stroke.c
|
||
* app/core/gimpimagemap.c
|
||
* app/core/gimpselection.c
|
||
* tools/pdbgen/pdb/color.pdb
|
||
* tools/pdbgen/pdb/transform_tools.pdb: either switch from
|
||
gimp_drawable_mask_bounds() to _intersect() or check the return
|
||
values of _mask_bounds() manually to avoid operations on empty
|
||
areas. Return successfully because it's a nop, not a failure.
|
||
Fixes bug #155733 for the core.
|
||
|
||
* app/pdb/color_cmds.c
|
||
* app/pdb/transform_tools_cmds.c: regenerated.
|
||
|
||
2004-10-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimptextoptions.c (gimp_text_options_gui): removed
|
||
3 mnemonics. No other tool options label has a mnemonic.
|
||
Addresses bug #155861.
|
||
|
||
2004-10-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/Makefile.am
|
||
* app/dialogs/vectors-options-dialog.[ch]: one more dialog split
|
||
out of actions/.
|
||
|
||
* app/actions/vectors-commands.c: removed it here. Merged more
|
||
utility functions into their only callers.
|
||
|
||
* app/actions/dockable-commands.c
|
||
* app/actions/edit-commands.c
|
||
* app/actions/file-commands.c
|
||
* app/actions/palettes-commands.c
|
||
* app/actions/tool-options-commands.c
|
||
* app/actions/view-commands.c: renamed "qbox" and "query_box"
|
||
variables to "dialog".
|
||
|
||
2004-10-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/screenshot.c (shoot_dialog): don't forget to set
|
||
the mnemonic widgets for the labels. Fixes bug #155811.
|
||
|
||
2004-10-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/Makefile.am
|
||
* app/dialogs/channel-options-dialog.[ch]: new files implementing
|
||
the channel options dialog with a horrid number of 13 construction
|
||
parameters. Still better than having the same code twice, only
|
||
differing in strings used...
|
||
|
||
* app/actions/channels-commands.c
|
||
* app/actions/qmask-commands.c: removed the dialog code here and
|
||
use channel_options_dialog_new().
|
||
|
||
2004-10-19 Jay Cox <jaycox@gimp.org>
|
||
|
||
* plug-ins/common/psd_save.c: don't try to save psd files that are
|
||
larger than 30000 pixels in either direction. Fixed the rle code
|
||
to compress more compactly. Fixed a memmory leak in
|
||
save_channel_data.
|
||
|
||
2004-10-18 Michael Natterer <mitch@gimp.org>
|
||
|
||
Action code review and pre-release consistency cleanup:
|
||
|
||
* app/actions/*-actions.c: added some missing and resolved
|
||
conflicting mnemonics, added missing help IDs. Cleaned up the
|
||
*_actions_update() functions.
|
||
|
||
* app/actions/channels-actions.c
|
||
* app/actions/layers-actions.c
|
||
* app/actions/vectors-actions.c (*_actions_update): simplified
|
||
the code that figures the prev and next channel,layer,vectors.
|
||
|
||
* app/actions/qmask-actions.c: use the same accelerator for
|
||
"qmask-active" and "qmask-toggle". Fixed action sensitivity.
|
||
|
||
* app/actions/channels-commands.c
|
||
* app/actions/dockable-commands.c
|
||
* app/actions/documents-commands.c
|
||
* app/actions/gradients-commands.c
|
||
* app/actions/layers-commands.c
|
||
* app/actions/palettes-commands.c
|
||
* app/actions/image-commands.c
|
||
* app/actions/select-commands.c
|
||
* app/actions/vectors-commands.c: folded tons of private utility
|
||
functions into their only callers (they used to be public and
|
||
called from outside before the switch to action based menus).
|
||
Renamed functions and variables saying "query" or "qbox" to
|
||
"dialog". Moved static functions to the end of the files. Misc
|
||
minor cleanups.
|
||
|
||
* app/actions/drawable-actions.c
|
||
* app/actions/drawable-commands.c: made the "drawable-visible" and
|
||
"drawable-linked" actions affect the layer if the active drawable
|
||
is a layer mask.
|
||
|
||
* app/actions/select-commands.c: added action to stroke with the
|
||
last values used in an attempt to address bug #135746 but #if 0'ed
|
||
it because the approach is too ugly.
|
||
|
||
* app/tools/gimpiscissorstool.c: changed mnemonic from I to S.
|
||
|
||
* menus/image-menu-xml.in: added more stuff to the (commented out)
|
||
"context" menu.
|
||
|
||
2004-10-17 DindinX <dindinx@gimp.org>
|
||
|
||
* libgimp/gimppixelrgn.c: some more clues in the documentation
|
||
(suggested by nomis)
|
||
|
||
2004-10-17 DindinX <dindinx@gimp.org>
|
||
|
||
* libgimp/gimppixelrgn.c: clarify some usecases for
|
||
gimp_pixel_rgn_init().
|
||
|
||
2004-10-17 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/colortoalpha.c: Added a preview.
|
||
|
||
2004-10-17 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/glasstile.c: use a GimpDrawablePreview.
|
||
|
||
2004-10-17 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/borderaverage.c: smallish cleanups.
|
||
|
||
2004-10-17 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/displace.c: Added a preview and minor cleanups.
|
||
Can someone provide useful testcases for this plug-in?
|
||
|
||
2004-10-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpitemtreeview.[ch]: moved "item_type" and
|
||
"signal_name" from GimpItemTreeView to GimpItemTreeViewClass.
|
||
Removed them from gimp_item_tree_view_new(). Require the view_type
|
||
instead of item_type in gimp_item_tree_view_new().
|
||
|
||
* app/widgets/gimpitemtreeview.c
|
||
* app/widgets/gimpdrawabletreeview.c (get_type): made them
|
||
abstract base classes.
|
||
|
||
* app/widgets/gimpchanneltreeview.c
|
||
* app/widgets/gimplayertreeview.c
|
||
* app/widgets/gimpvectorstreeview.c (class_init): set the
|
||
item_type and signal_name members if GimpItemTreeViewClass.
|
||
|
||
* app/dialogs/dialogs-constructors.c: changed accordingly.
|
||
|
||
2004-10-16 Manish Singh <yosh@gimp.org>
|
||
|
||
* autogen.sh: Add support for automake 1.9. Also rm autom4te.cache,
|
||
since it might interfere with differing autoconf versions.
|
||
|
||
2004-10-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpuimanager.[ch]: added utility function
|
||
gimp_ui_manager_get_action() which takes "group_name" and
|
||
"action_name".
|
||
|
||
* app/display/gimpdisplayshell-close.c
|
||
* app/widgets/gimpitemtreeview.c
|
||
* app/widgets/gimptoolbox.c
|
||
* app/widgets/gimptooloptionseditor.c: use it.
|
||
|
||
2004-10-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/channels-actions.c
|
||
* app/actions/colormap-editor-actions.c
|
||
* app/actions/documents-actions.c
|
||
* app/actions/tool-options-actions.c
|
||
* app/actions/vectors-actions.c: added more tooltips for actions
|
||
which are used as extended dialog button callbacks.
|
||
|
||
* app/widgets/gimpeditor.c (gimp_editor_add_action_button): keep
|
||
the list of extended actions in reverse order.
|
||
|
||
* app/widgets/gimpchanneltreeview.c
|
||
* app/widgets/gimpcolormapeditor.c
|
||
* app/widgets/gimpdocumentview.c
|
||
* app/widgets/gimpitemtreeview.c
|
||
* app/widgets/gimplayertreeview.c
|
||
* app/widgets/gimpselectioneditor.c
|
||
* app/widgets/gimptooloptionseditor.c
|
||
* app/widgets/gimpvectorstreeview.c: don't set the tooltips
|
||
manually. Removes another bunch of insane translatable multiline
|
||
format strings. Pass the extended actions in the right order
|
||
to gimp_editor_add_action_button().
|
||
|
||
2004-10-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/vectors-commands.c (vectors_linked_cmd_callback):
|
||
call gimp_item_set_linked(), not gimp_item_set_visible().
|
||
Fixes bug #155578
|
||
|
||
2004-10-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
Ported the layers, channels and paths dialogs from
|
||
gimp_editor_add_button() to gimp_editor_add_action_button(),
|
||
removing a massive amount of duplicated code, sensitivity logic
|
||
and confusing utility functions.
|
||
|
||
* app/actions/channels-actions.c
|
||
* app/actions/channels-commands.[ch]
|
||
* app/actions/layers-actions.c
|
||
* app/actions/layers-commands.[ch]
|
||
* app/actions/vectors-actions.c
|
||
* app/actions/vectors-commands.[ch]: added "foo-new-default"
|
||
actions and callbacks which create items without a dialog,
|
||
optionally using default values from a passed template. Removed
|
||
all public utility function that were passed as function pointers
|
||
to widget construtors. Added tooltips to all actions which are now
|
||
used for dialog buttons.
|
||
|
||
* app/widgets/gimpeditor.c (gimp_editor_add_action_button):
|
||
automatically create multi-line tooltips showing the modifiers for
|
||
extended action buttons. Removes the need for lots of insane
|
||
format strings that need to be translated correctly.
|
||
|
||
* app/widgets/gimpitemtreeview.[ch] (struct GimpItemTreeViewClass):
|
||
replaced tooltip and help_id strings by action names.
|
||
|
||
(struct GimpItemTreeView)
|
||
(gimp_item_tree_view_new): removed "edit", "new" and "activate"
|
||
function pointers.
|
||
|
||
(gimp_item_tree_view_constructor): create all buttons
|
||
with gimp_editor_add_action_button(), using the action names
|
||
from GimpItemTreeViewClass.
|
||
|
||
Removed tons of "clicked" callbacks and all code which sets the
|
||
buttons' sensitivity. They are not needed any longer.
|
||
|
||
Require all subclasses to implement GimpItemTreeView::new_item(),
|
||
a new virtual function which creates a plain new item without
|
||
showing a dialog.
|
||
|
||
* app/widgets/gimpdrawabletreeview.c
|
||
* app/widgets/gimpchanneltreeview.c
|
||
* app/widgets/gimplayertreeview.c
|
||
* app/widgets/gimpvectorstreeview.c: fill in the action names and
|
||
implement GimpItemTreeView::new_item(). Removed all button
|
||
sensitivity logic.
|
||
|
||
* app/dialogs/dialogs-constructors.c: changed accordingly. Doesn't
|
||
include anything from actions/ any more.
|
||
|
||
2004-10-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/layer.pdb: fixed parameter descriptions for
|
||
layer_add_mask() and layer_remove_mask().
|
||
|
||
* app/pdb/layer_cmds.c
|
||
* libgimp/gimplayer_pdb.c: regenerated.
|
||
|
||
2004-10-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/images-commands.[ch]
|
||
* app/actions/templates-commands.[ch]: made some public functions
|
||
private or removed them entirely by folding their code into their
|
||
callers. They used to be passed as function pointers to widgets in
|
||
the pre action-based dialog buttons era.
|
||
|
||
2004-10-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/quit-dialog.c: raise the image's displays on
|
||
double-click in the dirty image list.
|
||
|
||
2004-10-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
Fixed bug #155328:
|
||
|
||
* app/actions/vectors-actions.c (vectors_actions_update): don't
|
||
set the "selection to path" actions sensitive if there is no
|
||
image.
|
||
|
||
* app/widgets/gimpitemtreeview.c: update the UI manager after
|
||
setting the view's image. Connect to GimpImage::flush() and
|
||
update the UI manager in the callback, too.
|
||
|
||
2004-10-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/view-actions.c (view_zoom_actions): removed
|
||
duplicate "view-zoom-in" action (cut'n'paste error) and fixed the
|
||
swapped "zoom in/out a lot" actions. Fixes bug #155446.
|
||
|
||
2004-10-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* Made 2.1.7 release.
|
||
|
||
2004-10-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimptransformoptions.c: removed the "Density" label.
|
||
It wasn't helpful and caused the transform options to be wider than
|
||
necessary.
|
||
|
||
* app/tools/gimpblendoptions.c
|
||
* app/tools/gimppaintoptions-gui.c
|
||
* app/tools/gimptransformoptions.c: let combo boxes expand
|
||
horizontally like we do in other (all?) dialogs.
|
||
|
||
* app/widgets/gimptemplateeditor.c
|
||
(gimp_template_editor_aspect_callback): update the pixel size label.
|
||
|
||
2004-10-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* data/images/gimp-splash.png: new splash by Jimmac.
|
||
|
||
2004-10-15 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/scatter_hsv.c: ported to GimpDrawablePreview, and
|
||
removed many lines of codes.
|
||
|
||
2004-10-14 Kevin Cozens <kcozens@cvs.gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/neon.scm: Fixed minor error in script.
|
||
(Related to bug #153900 and compatability with Tiny-Fu)
|
||
|
||
2004-10-14 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/neon.c: fixed the handling of drawable with alpha.
|
||
|
||
2004-10-14 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/nlfilt.c: Ported to GimpDrawablePreview, the
|
||
previous preview was absolutely useless. Done some cleanups, too.
|
||
|
||
* plug-ins/common/spread.c: remember the preview state between
|
||
invocations.
|
||
|
||
2004-10-14 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/emboss.c: use a GimpDrawablePreview instead of a
|
||
GimpAspectPreview, since this plug-in is somewhat edge-oriented and
|
||
this makes the code simpler ;)
|
||
|
||
2004-10-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* themes/Default/images/stock-gradient-bilinear-16.png
|
||
* themes/Default/images/stock-gradient-linear-16.png: rotate them
|
||
by 90 degrees. All our gradient previews and icons go left->right,
|
||
not top->bottom.
|
||
|
||
2004-10-14 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/common/bmpread.c: Make sure we have a bpp value we can
|
||
handle, and fail gracefully if not. Fixes bug #155401.
|
||
|
||
2004-10-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimpwidgets.c
|
||
* app/widgets/gimpenumwidgets.[ch]
|
||
* app/widgets/gimppropwidgets.c
|
||
* app/actions/layers-commands.c
|
||
* app/dialogs/convert-dialog.c
|
||
* app/tools/gimpblendoptions.c
|
||
* app/tools/gimpbucketfilloptions.c
|
||
* app/tools/gimpcolorbalancetool.c
|
||
* app/tools/gimpcolorizetool.c
|
||
* app/tools/gimpcoloroptions.c
|
||
* app/tools/gimpcurvestool.c
|
||
* app/tools/gimphuesaturationtool.c
|
||
* app/tools/gimpinkoptions-gui.c
|
||
* app/tools/gimplevelstool.c
|
||
* app/tools/gimppaintoptions-gui.c
|
||
* app/tools/gimpselectionoptions.c
|
||
* app/tools/gimptransformoptions.c: the child of a GimpFrame must
|
||
not have any border width. Fixes many subtle misalignments.
|
||
|
||
2004-10-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpprogress.[ch]: added "message" function to the
|
||
GimpProgress interface. Call gimp_message() if it is unimplemented.
|
||
|
||
* app/plug-in/plug-in-progress.[ch]: added new function
|
||
plug_in_progress_message() that passes the message to the current
|
||
proc_frame's progress.
|
||
|
||
* app/widgets/gimpthumbbox.c: implement GimpProgress::message.
|
||
Just do nothing in the implementation. We don't want to see
|
||
messages from file plug-ins that we use to create the thumbnails.
|
||
|
||
* tools/pdbgen/pdb/message.pdb
|
||
* app/pdb/message_cmds.c: if there's a current plug-in, dispatch
|
||
the message by calling plug_in_progress_message().
|
||
|
||
* app/display/gimpdisplayshell-close.c: fixed wrong types in
|
||
function calls.
|
||
|
||
2004-10-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcolordialog.c (gimp_color_dialog_new): use
|
||
GIMP_HELP_COLOR_DIALOG as help_id.
|
||
|
||
2004-10-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/dialogs-commands.c: purely cosmetic.
|
||
|
||
2004-10-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/core-enums.[ch]: register GimpConvertPaletteType with
|
||
the type system.
|
||
|
||
* tools/pdbgen/enums.pl: regenerated.
|
||
|
||
* app/widgets/gimpwidgets-utils.c (gimp_enum_radio_frame_add):
|
||
fixed to insert the widget at the right place in the radio box.
|
||
|
||
* app/dialogs/convert-dialog.c: use enum widgets and
|
||
gimp_enum_radio_frame_add(), resulting in a much better looking
|
||
dialog with much less lines of code.
|
||
|
||
2004-10-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/helpbrowser/dialog.c: changed "Home" button to "Index".
|
||
"Home" is misleading and leads to problems in some locales (see
|
||
bug #148120).
|
||
|
||
2004-10-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/authorsgen/contributors: correct UTF-8 spelling of
|
||
João S. O. Bueno Calligaris.
|
||
|
||
* AUTHORS
|
||
* app/dialogs/authors.h: regenerated.
|
||
|
||
2004-10-14 Kevin Cozens <kcozens@cvs.gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/circuit.scm: Fixed to allow use of
|
||
script on original layer. (bug #155358) Fixed spelling error.
|
||
|
||
2004-10-13 Manish Singh <yosh@gimp.org>
|
||
|
||
* tools/pdbgen/Makefile.am: Remove stamp files during
|
||
maintainer-clean. Addresses bug #155357. Also flesh out the
|
||
dependencies some so rebuilds get triggered when all their
|
||
dependent files change.
|
||
|
||
2004-10-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/file-commands.c (file_revert_cmd_callback): creata
|
||
an UTF-8 filename from the image URI and display that instead of
|
||
the URI.
|
||
|
||
* app/dialogs/convert-dialog.c (convert_dialog_new): removed the
|
||
palette size warning for transparent images. The number of colors
|
||
is already adjusted to 255. This text was IMO more frightening
|
||
than helpful.
|
||
|
||
2004-10-13 Kevin Cozens <kcozens@cvs.gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/add-bevel.scm: two variables were
|
||
not defined before first use (bug #153900).
|
||
|
||
2004-10-13 Kevin Cozens <kcozens@cvs.gimp.org>
|
||
|
||
* app/widgets/gimpactionview.c: Fixed a spelling error.
|
||
|
||
2004-10-13 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/colorify.c: Added a preview.
|
||
|
||
2004-10-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreview.c: removed trailing whitespace.
|
||
|
||
* libgimpwidgets/gimpwidgets.def: added
|
||
gimp_preview_set_default_cursor.
|
||
|
||
2004-10-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpmessagedialog.c: improved handling of parent
|
||
widget; probably just being paranoid here.
|
||
|
||
* app/actions/image-commands.c
|
||
* app/dialogs/image-new-dialog.c: ported memory size confirmation
|
||
dialogs to GimpMessageDialog.
|
||
|
||
2004-10-13 DindinX <dindinx@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreview.[ch]: added a new function to set the
|
||
default cursor on preview: gimp_preview_set_default_cursor().
|
||
|
||
* libgimpwidgets/gimpscrolledpreview.c: changed accordlingly.
|
||
|
||
* plug-ins/common/flarefx.c:
|
||
* plug-ins/common/nova.c: use this function.
|
||
|
||
This addresses bug #90519.
|
||
|
||
2004-10-13 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/cubism.c: Added a preview and done some cleanups.
|
||
|
||
2004-10-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/plug-in-commands.c
|
||
* app/actions/templates-commands.c
|
||
* app/actions/tool-options-commands.c: ported more boolean queries
|
||
to GimpMessageDialog.
|
||
|
||
2004-10-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpmessagedialog.c: handle parent widget not being
|
||
a GtkWindow by calling gtk_widget_get_toplevel().
|
||
|
||
* app/actions/data-commands.c
|
||
* app/actions/edit-commands.c
|
||
* app/actions/file-commands.c: ported more boolean queries to
|
||
GimpMessageDialog.
|
||
|
||
2004-10-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpmessagedialog.[ch]: added a simple message
|
||
dialog to avoid code duplication.
|
||
|
||
* app/widgets/gimpmessagebox.c: set the border width to 12 pixels.
|
||
|
||
* app/dialogs/file-save-dialog.c
|
||
* app/dialogs/quit-dialog.c
|
||
* app/display/gimpdisplayshell-close.c
|
||
* app/widgets/gimperrordialog.c
|
||
* app/widgets/gimphelp.c
|
||
* app/widgets/gimpactionview.c: use the new GimpMessageDialog.
|
||
|
||
2004-10-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/image-actions.c
|
||
* menus/image-menu.xml.in: added menu branch "<Image>/Image/Guides".
|
||
|
||
* plug-ins/script-fu/scripts/Makefile.am
|
||
* plug-ins/script-fu/scripts/guides-from-selection.scm
|
||
* plug-ins/script-fu/scripts/guides-new-percent.scm
|
||
* plug-ins/script-fu/scripts/guides-new.scm
|
||
* plug-ins/script-fu/scripts/guides-remove-all.scm: added new
|
||
scripts from Alan Horkan. Fixes bug #119667.
|
||
|
||
2004-10-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/flarefx.c: cleaned up and simplified the
|
||
FlareCenter code even more.
|
||
|
||
* plug-ins/common/nova.c: did the same changes for the NovaCenter
|
||
stuff.
|
||
|
||
Also added code which sets an appropriate cursor on "realize" to
|
||
fix bug #90519, but GimpPreview currently prevents this from
|
||
working correctly...
|
||
|
||
2004-10-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/widgets-enums.[ch]: changed the description for
|
||
GIMP_HELP_BROWSER_GIMP.
|
||
|
||
* app/dialogs/file-save-dialog.c:
|
||
* app/widgets/gimphelp.c: use a GimpDialog embedding a
|
||
GimpMessageBox instead of gimp_query_boolean_box which looks
|
||
somewhat old fashioned.
|
||
|
||
2004-10-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimphelp.c: improved error messages on missing help
|
||
browser plug-in.
|
||
|
||
* libgimpthumb/gimpthumb-utils.c
|
||
* libgimpthumb/gimpthumbnail.c: improved documentation.
|
||
|
||
2004-10-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-close.c
|
||
(gimp_display_shell_close_dialog): changed button label.
|
||
|
||
2004-10-12 Kevin Cozens <kcozens@cvs.gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/asc2img.scm: Fixed error in name of
|
||
script used in second register line.
|
||
|
||
2004-10-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-close.c: changed rounding.
|
||
|
||
2004-10-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/image-new-dialog.c (image_new_response): don't
|
||
forget to reset the template combo on RESPONSE_RESET.
|
||
|
||
2004-10-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplay-foreach.c: keep the container of dirty
|
||
images up to date.
|
||
|
||
* app/dialogs/quit-dialog.c: fixed model/view behavior here, too.
|
||
|
||
(both are still far from perfect)
|
||
|
||
2004-10-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-close.c
|
||
(gimp_display_shell_close_dialog): keep the time uptodate.
|
||
|
||
2004-10-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpimagefile.c (gimp_imagefile_create_thumbnail): ref
|
||
the imagefile while creating the thumbnail.
|
||
|
||
* app/core/gimpimagefile.[ch]
|
||
* app/widgets/gimpthumbbox.c (gimp_thumb_box_auto_thumbnail): moved
|
||
the tricky part about thumbnail creation into the new function
|
||
gimp_imagefile_create_thumbnail_weak().
|
||
|
||
2004-10-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/pagecurl/pagecurl.c: forgot to remove N_() from
|
||
gimp_plugin_menu_register().
|
||
|
||
2004-10-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/preferences-dialog.c (prefs_dialog_new): added
|
||
missing and resolved conflicting mnemonics.
|
||
|
||
2004-10-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/selection-round.scm: moved out of the
|
||
"Modify" placeholder. Using placeholders from Script-Fu breaks
|
||
i18n. We will need to change menu registration for scripts but
|
||
this will have to wait..
|
||
|
||
2004-10-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/*/*.c: all plug-ins except script-fu: removed the
|
||
translation marks from the menu paths passed to
|
||
gimp_plugin_menu_register(). All default menu branches used by
|
||
included plug-ins are created and translated by the core now.
|
||
|
||
2004-10-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpimage.[ch]: renamed struct member "unit" to
|
||
"resolution_unit".
|
||
|
||
* app/actions/image-commands.c
|
||
* app/core/gimp-edit.c
|
||
* app/core/gimpimage-duplicate.c
|
||
* app/core/gimpimage-undo-push.c
|
||
* app/dialogs/info-window.c
|
||
* app/vectors/gimpvectors-export.c
|
||
* app/widgets/gimptoolbox-dnd.c:
|
||
* app/xcf/xcf-load.c
|
||
* app/xcf/xcf-save.c: changed accordingly. Use gimp_image_get_unit()
|
||
where appropriate.
|
||
|
||
* app/core/gimptemplate.c (gimp_template_set_from_image): fixed
|
||
unit handling. Don't touch the template unit, it is used as the
|
||
initial display unit. This will need further changes...
|
||
|
||
2004-10-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpwidgets-utils.c (gimp_enum_radio_frame_add):
|
||
need to pack the widget expanding. Fixes pattern container
|
||
entries.
|
||
|
||
2004-10-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/info-window.[ch]: fixed unit handling. Right-align
|
||
the labels displaying the cursor position. Renamed the "Extended"
|
||
tab to "Cursor". Renamed the API accordingly.
|
||
|
||
* app/display/gimpdisplayshell-cursor.c: changed accordingly.
|
||
|
||
2004-10-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/drawable-commands.c (drawable_rotate_cmd_callback):
|
||
if the drawable is a channel, pass clip_result as FALSE. Need to
|
||
do this here for rotating only because it can't be decided
|
||
generically in GimpChannel. Fixes crash when rotating channels
|
||
or layer masks.
|
||
|
||
Use the undo_desc from GimpItemClass instead of passing "Flip
|
||
Layer" and "Rotate Layer".
|
||
|
||
2004-10-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/file/file-open.c: minor cleanup.
|
||
|
||
* app/file/file-save.c (file_save_as): no need to fiddle with the
|
||
image name, the URI is taken from the imagefile anyway.
|
||
|
||
2004-10-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/layers-actions.c (layers_actions_update): set
|
||
"layers-crop" insensitive if the selection is empty.
|
||
|
||
* plug-ins/script-fu/scripts/alien-glow-button.scm
|
||
* plug-ins/script-fu/scripts/alien-glow-logo.scm
|
||
* plug-ins/script-fu/scripts/basic2-logo.scm
|
||
* plug-ins/script-fu/scripts/gradient-bevel-logo.scm: use "Sans
|
||
Bold" instead of "Futura_Poster". The underscore in the font name
|
||
used to confuse intltool (bug #137029) and the freefont package
|
||
isn't that widely used any longer anyway.
|
||
|
||
2004-10-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpsizebox.[ch]: added new widget GimpSizeBox.
|
||
|
||
* app/widgets/gimppropwidgets.c: the order of setting the X and Y
|
||
properties does matter.
|
||
|
||
* app/dialogs/Makefile.am
|
||
* app/dialogs/scale-dialog.[ch]: added first version of a new
|
||
Scale dialog in an attempt to address bug #151022.
|
||
|
||
* app/actions/layers-commands.c: use the new scale dialog.
|
||
|
||
2004-10-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimptemplateeditor.c: added mnemonics for the size
|
||
entries.
|
||
|
||
2004-10-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimpwidgets.c (gimp_table_attach_aligned):
|
||
instead of simply using the passed widget as mnemonic_widget for
|
||
the GtkLabel, call the new utility function find_mnemonic_widget()
|
||
which recursively searches the passed widget until it finds one
|
||
that actually can be mnemonic-activated. Fixes lots of mnemonics
|
||
where the attached widget is e.g. a GtkEventBox or GtkComboBox.
|
||
|
||
2004-10-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimptooloptions-gui.[ch]: removed the recently added
|
||
utility functions again.
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/gimpviewablebox.[ch]
|
||
* app/widgets/gimpwidgets-utils.[ch]: and added cleaned up
|
||
versions here.
|
||
|
||
* app/tools/gimpbucketfilloptions.c
|
||
* app/tools/gimpclonetool.c
|
||
* app/tools/gimppaintoptions-gui.c
|
||
* app/tools/gimptextoptions.c: changed accordingly.
|
||
|
||
* app/dialogs/convert-dialog.c: use gimp_palette_box_new() instead
|
||
of reinventing the wheel.
|
||
|
||
2004-10-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpaction.c (gimp_action_set_proxy): use a larger
|
||
icon size for GimpImagefile views.
|
||
|
||
* themes/Default/images/stock-frame-64.png: removed the 1 pixel
|
||
wide empty border around the frame.
|
||
|
||
* app/widgets/gimpviewrenderer-frame.c: adjusted the hardcoded values.
|
||
|
||
2004-10-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* Makefile.am: defined DISTCHECK_CONFIGURE_FLAGS with the
|
||
configure options that are needed to run 'make dist'.
|
||
|
||
2004-10-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimptemplateeditor.c: tweaked table spacings to get
|
||
the Height label aligned with the entry again.
|
||
|
||
2004-10-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpprogressdialog.c (gimp_progress_dialog_new): set
|
||
the "skip_taskbar_hint" and "skip_pager_hint" properties on the
|
||
progress window.
|
||
|
||
2004-10-11 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/fp/fp.c: Moved from here...
|
||
|
||
* plug-ins/common/fp.c: ... to here.
|
||
|
||
* plug-ins/common/plugin-defs.pl: changed accordingly.
|
||
|
||
* plug-ins/common/.cvsignore
|
||
* plug-ins/common/Makefile.am: regenerated.
|
||
|
||
* configure.in
|
||
* plug-ins/Makefile.am
|
||
* plug-ins/fp: Removed directory.
|
||
|
||
2004-10-11 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/jigsaw.c: ported to GimpAspectPreview.
|
||
|
||
2004-10-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/flarefx.c: use a GimpSizeEntry for specifying
|
||
the flare center. Fixed flare center dragging. Lots of cleanup.
|
||
|
||
2004-10-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/dialogs-types.h: removed ColorDialog typedef.
|
||
|
||
2004-10-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimptooloptions-gui.[ch]: added utility functions
|
||
which create a GimpViewableButton+GimpContainerEntry combo for
|
||
brushes, patterns, gradients and fonts and a very ugly utility
|
||
function which packs one of these combos into a GtkFrame returned
|
||
by gimp_prop_enum_radio_frame_new(). This stuff does not really
|
||
belong here but is too ugly to be moved to a more general place.
|
||
|
||
* app/tools/gimpbucketfilloptions.c
|
||
* app/tools/gimppaintoptions-gui.c
|
||
* app/tools/gimptextoptions.c: use the new utility functions. Moved
|
||
the pattern previews into the radio frame where using the pattern
|
||
is selected. Make them insensitive if using the pattern is not
|
||
selected.
|
||
|
||
2004-10-11 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/config/gimprc-blurbs.h: tweaked the thumbnail related blurbs.
|
||
|
||
* app/dialogs/preferences-dialog.c: group the thumbnail related
|
||
controls together. Could probably still be improved...
|
||
|
||
2004-10-11 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/documents-commands.c
|
||
(documents_recreate_preview_cmd_callback): when recreating the
|
||
thumbnail, delete old thumbnails and create it in the configured
|
||
thumbnail size instead of the container view preview size.
|
||
|
||
* libgimpthumb/gimpthumbnail.c (gimp_thumbnail_update_thumb):
|
||
reset the image info when the thumbnail state changes.
|
||
|
||
2004-10-11 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpfiledialog.c: construct a case-insensitive glob
|
||
pattern to use when filtering for file extensions.
|
||
|
||
2004-10-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnails):
|
||
user-visible counting starts at 1, not 0.
|
||
|
||
2004-10-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/authorsgen/contributors: added missing contributors.
|
||
Thanks to Kevin Cozens for going through ChangeLog and making a list.
|
||
|
||
* AUTHORS
|
||
* app/dialogs/authors.h: regenerated.
|
||
|
||
2004-10-11 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpthumb/gimpthumbnail.c: ooops, forgot to disable the debug
|
||
output again.
|
||
|
||
2004-10-11 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/batch.c: clarified.
|
||
|
||
2004-10-08 Kevin Cozens <kcozens@cvs.gimp.org>
|
||
|
||
* configure.in: removed duplicate GETTEXT_PACKAGE line.
|
||
|
||
2004-10-11 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpthumb/gimpthumb-utils.[ch]
|
||
* libgimpthumb/gimpthumb.def: added an API to delete thumbnails.
|
||
|
||
* app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnail):
|
||
when recreating a thumbnail on user request, delete all existing
|
||
thumbnails for it.
|
||
|
||
* plug-ins/common/AlienMap2.c: removed unused variable.
|
||
|
||
2004-10-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpthumb/gimpthumb-utils.[ch]
|
||
* libgimpthumb/gimpthumb.def
|
||
* libgimpthumb/gimpthumbnail.c: added support for local thumbnails
|
||
as introduced by version 0.7 of the thumbnail spec. Untested, but
|
||
at least the API is there.
|
||
|
||
2004-10-10 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/AlienMap2.c: ported to GimpAspectPreview, and some
|
||
minor cleanups.
|
||
|
||
2004-10-10 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/vpropagate.c: added a preview.
|
||
|
||
2004-10-10 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/flarefx.c
|
||
* plug-ins/common/waves.c: cleanups and ported to GimpAspectPreview.
|
||
|
||
2004-10-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpcontainerview.c (gimp_container_view_lookup):
|
||
handle NULL as viewable parameter as a workaround for bug #149906.
|
||
|
||
* app/widgets/gimpthumbbox.c (gimp_thumb_box_auto_thumbnail): made
|
||
the code more robust.
|
||
|
||
* app/xcf/xcf-private.h
|
||
* app/xcf/xcf.c: added a const qualifier.
|
||
|
||
2004-10-09 DindinX <dindinx@gimp.org>
|
||
|
||
* app/dialogs/dialogs.h: fixed a typo in the double-inclusion guard.
|
||
|
||
2004-10-09 Sven Neumann <sven@gimp.org>
|
||
|
||
* AUTHORS
|
||
* app/dialogs/authors.h: regenerated. Someone should look into
|
||
updating the list of contributors for the 2.2 release ...
|
||
|
||
2004-10-08 Kevin Cozens <kcozens@cvs.gimp.org>
|
||
|
||
* tools/authorsgen/contributors: Added my name to the
|
||
list of contributors.
|
||
|
||
2004-10-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpthumbbox.c: tweaked the text shown while
|
||
updating the preview so that the dialog doesn't need to resize.
|
||
|
||
2004-10-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/config/gimpcoreconfig.[ch]
|
||
* app/config/gimprc-blurbs.h: added new gimprc option
|
||
"thumbnail-filesize-limit" that allows to control the maximum
|
||
filesize for automatic thumbnail creation.
|
||
|
||
* app/dialogs/preferences-dialog.c: added a GUI for it, needs
|
||
review.
|
||
|
||
* app/core/gimpimagefile.[ch]: minor cleanups. Moved call to
|
||
gimp_thumbnail_peek_image() from gimp_imagefile_save_thumb() to
|
||
gimp_imagefile_save_thumbnail() to avoid it being called twice.
|
||
|
||
* app/file/file-utils.[ch]: export utility function
|
||
file_utils_find_proc_by_extension() that allows to check for a
|
||
file plug-in by looking at the filename extension only.
|
||
|
||
* app/widgets/gimpthumbbox.[ch]: automatically create or update
|
||
thumbnails for image files with a known extension that are smaller
|
||
than "thumbnail-filesize-limit". Fixes bug #137176.
|
||
|
||
2004-10-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/ripple.c: handle the tile parameter identically
|
||
for preview and final result. Set Edges options insensitive when
|
||
"Retain tileability" is checked. Reported by Olivier.
|
||
|
||
2004-10-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/apply_lens.c (lens_dialog): invalidate the
|
||
preview when the toggle buttons are used. Reported by Olivier.
|
||
|
||
* app/widgets/gimpview.c: minor cleanup.
|
||
|
||
2004-10-08 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimpmeasuretool.c: implement GimpTool::key_press() and
|
||
cancel the tool on GDK_Escape. Come cleanup.
|
||
|
||
2004-10-08 Michael Natterer <mitch@gimp.org>
|
||
|
||
Made the text options about two toolbox grid columns smaller.
|
||
Addresses bug #122862.
|
||
|
||
* app/widgets/gimppropwidgets.c (gimp_prop_size_entry_new): use
|
||
the number of digits of the property's max_val plus two as number
|
||
of chars for the sizeentry'y spinbutton (instead of always 10 as
|
||
before).
|
||
|
||
* app/tools/gimptextoptions.c (gimp_text_options_gui): GtkEntry
|
||
has a minimal width of 150 pixels (eek). Set a silly small minimal
|
||
width instead (the entry expands to the available width anyway).
|
||
|
||
2004-10-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/file/file-utils.c: added lots of const qualifiers.
|
||
|
||
2004-10-08 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimppaintoptions-gui.c: the gradient button in blend
|
||
options got lost, added it back. Also moved creation of the brush,
|
||
pattern and gradient buttons to utility functions and cleaned up
|
||
the whole file a bit.
|
||
|
||
2004-10-08 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell.c (gimp_display_shell_real_scaled)
|
||
(gimp_display_shell_flush)
|
||
* app/gui/gui-vtable.c (gui_display_create): always pass a
|
||
GimpDisplay, not a GimpDisplayShell as "data" to
|
||
gimp_ui_manager_update().
|
||
|
||
* app/actions/actions.c (action_data_get_*): removed checks if the
|
||
passed data is a GimpDisplayShell and temporarily added g_assert()
|
||
to be sure. The assertions will be removed before 2.2.
|
||
|
||
2004-10-07 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpthumb/gimpthumbnail.c: added some (disabled) debug output.
|
||
|
||
* app/widgets/gimpviewrenderer-frame.[ch]: added a way to retrieve
|
||
the size of the frame borders.
|
||
|
||
* app/widgets/gimpthumbbox.c: don't set an arbitrary padding but
|
||
exactly the size of the frame borders. Otherwise we get large
|
||
thumbnails (scaled down) if we request normal sized ones.
|
||
|
||
2004-10-07 Kevin Cozens <kcozens@cvs.gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/selection-round.scm: Changed deprecated
|
||
constant ADD to CHANNEL-OP-ADD.
|
||
|
||
2004-10-07 Michael Natterer <mitch@gimp.org>
|
||
|
||
Merged the gz and bz2 plug-ins into one generic compression
|
||
handler that can be extended by adding entries to a table of
|
||
compressor definitions:
|
||
|
||
* configure.in: removed bz2 special casing for win32.
|
||
|
||
* plug-ins/common/bz2.c
|
||
* plug-ins/common/gz.c: removed.
|
||
|
||
* plug-ins/common/compressor.c: new plug-in.
|
||
|
||
* plug-ins/common/plugin-defs.pl: changed accordingly.
|
||
|
||
* plug-ins/common/.cvsignore
|
||
* plug-ins/common/Makefile.am: regenerated.
|
||
|
||
2004-10-07 Simon Budig <simon@gimp.org>
|
||
|
||
* app/actions/view-commands.c: fill in the formula... :-)
|
||
untabbified.
|
||
|
||
* app/display/gimpdisplayshell-scale.c: Micro-Cleanup, untabbified.
|
||
|
||
2004-10-07 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/view-actions.c: changed zoom actions to be
|
||
GimpEnumActions using the GimpActionSelectType enum. Enables
|
||
keyboard shortcuts for useless stuff like "zoom out a lot", and
|
||
makes them better accessible for external controllers.
|
||
|
||
* app/actions/view-commands.[ch]: renamed view_zoom_cmd_callback()
|
||
to view_zoom_explicit_cmd_callback(), removed the zoom_in and
|
||
zoom_out callbacks and added a new view_zoom_cmd_callback() for
|
||
the new GimpActionSelectType-based actions. The implementation of
|
||
the new zoom types is questionable but now there is a place where
|
||
nomis can fill in nice formulas...
|
||
|
||
2004-10-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimpeditselectiontool.[ch]: added new parameter
|
||
"gboolean propagate_release" to gimp_edit_slection_tool_start()
|
||
and remember it in the GimpEditSelectionTool struct. If requested,
|
||
propagate GimpTool::button_release() to the tool below in the tool
|
||
stack.
|
||
|
||
* app/tools/gimpselectiontool.c (gimp_selection_tool_start_edit):
|
||
pass FALSE so we don't get the button_release().
|
||
|
||
* app/tools/gimpmovetool.[ch]: pass TRUE so we get
|
||
button_release(). If moving a layer or path in "pick active" mode,
|
||
remember the old active layer/path and switch back to it in
|
||
button_release(). Fixes bug #97734.
|
||
|
||
Unrelated:
|
||
|
||
* app/tools/gimpeditselectiontool.c
|
||
(gimp_edit_selection_tool_motion): set "first_move" to FALSE only
|
||
if a move actually happened. Fixes un-undoable moves at high zoom
|
||
factors.
|
||
|
||
2004-10-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpdnd.c (gimp_dnd_data_drag_begin): remember for
|
||
which GdkDragContext the icon_widget was made.
|
||
|
||
(gimp_dnd_data_drag_end): destroy the icon_widget only if it was
|
||
created for this GdkDragContext. Fixes broken DND icon_widgets
|
||
when dragging the same source again while the old icon_widget is
|
||
still floating back from an unsuccessful drop. Fixes bug #139337.
|
||
|
||
2004-10-05 Manish Singh <yosh@gimp.org>
|
||
|
||
* tools/pdbgen/lib.pl: Slight cleanup of doc generating code.
|
||
|
||
2004-10-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/lib.pl: for deprecated procedures, create a gtk-doc
|
||
comment that contains a link to the replacement procedure and
|
||
doesn't contain redundant information.
|
||
|
||
* tools/pdbgen/pdb/text_tool.pdb: fixed names of replacement
|
||
procedures.
|
||
|
||
* libgimp/gimpbrushes.c
|
||
* libgimp/gimpgradients.c
|
||
* libgimp/gimppalettes.c
|
||
* libgimp/gimppatterns.c: made the handwritten gtk-doc comments of
|
||
deprecated procedures look like the generated ones.
|
||
|
||
* app/pdb/text_tool_cmds.c
|
||
* libgimp/gimpbrushes_pdb.c
|
||
* libgimp/gimpgradients_pdb.c
|
||
* libgimp/gimppalettes_pdb.c
|
||
* libgimp/gimppatterns_pdb.c
|
||
* libgimp/gimptexttool_pdb.c: regenerated.
|
||
|
||
2004-10-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimp-tools.c (gimp_tools_restore): reset the tool
|
||
options before deserializing so they have the correct default
|
||
values. Fixes bug #120832.
|
||
|
||
* app/tools/gimpbucketfilloptions.c
|
||
* app/tools/gimpmagnifyoptions.c
|
||
* app/tools/gimpselectionoptions.c
|
||
* app/tools/gimptransformoptions.c: removed all set_defaults()
|
||
utility functions and moved their code to reset(). The change
|
||
above calls them automatically so there is no need to call them
|
||
from the GUI constructors any more.
|
||
|
||
2004-10-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/selection-round.scm: use a
|
||
scale_entry instead of a spinbutton, changed mnemonic from "R" to
|
||
"E", indentation.
|
||
|
||
* plug-ins/script-fu/scripts/test-sphere.scm: s/SF_BRUSH/SF-BRUSH/
|
||
in a comment.
|
||
|
||
2004-10-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/selection-round.scm: applied patch by
|
||
Alan Horkan that improves usability and usefulness of this script.
|
||
Did some code cleanup and added the old procedure for backward
|
||
compatibility. Fixes bug #145147.
|
||
|
||
* menus/image-menu.xml.in: renamed placeholder in Image->Select
|
||
from "Outline" to "Modify".
|
||
|
||
2004-10-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/postscript.c (ps_open): tweaked error message.
|
||
|
||
2004-10-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/pdb/procedural_db.h (struct ProcRecord): changed new member
|
||
"deprecated" from "gboolean" to a "gchar*" which holds the name of
|
||
the replacement procedure.
|
||
|
||
* tools/pdbgen/app.pl: changed accordingly.
|
||
|
||
* app/plug-in/plug-in-message.c (plug_in_handle_proc_run): show
|
||
the name of the replacement procedure in the warning message.
|
||
|
||
* tools/pdbgen/stddefs.pdb: added utility function
|
||
std_pdb_deprecated() which takes the name of the replacement
|
||
procedure and fills the blurb, help, author, copyright, date and
|
||
deprecated fields of the procedure definition.
|
||
|
||
* tools/pdbgen/pdb/brushes.pdb
|
||
* tools/pdbgen/pdb/gradients.pdb
|
||
* tools/pdbgen/pdb/image.pdb
|
||
* tools/pdbgen/pdb/palettes.pdb
|
||
* tools/pdbgen/pdb/patterns.pdb
|
||
* tools/pdbgen/pdb/text_tool.pdb: use it instead of duplicating
|
||
the same code and strings for all deprecated procedures.
|
||
|
||
* app/pdb/*_cmds.c
|
||
* libgimp/gimppatterns_pdb.c
|
||
* libgimp/gimptexttool_pdb.c: regenerated.
|
||
|
||
2004-10-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
Fixed the scale constraints radio buttons:
|
||
|
||
* app/tools/gimptransformoptions.c (gimp_transform_options_gui):
|
||
initialize the radio group with the correct value instead of
|
||
resetting the model before creating the group.
|
||
|
||
(gimp_scale_options_constrain_callback): change the model
|
||
only if the radio button became active.
|
||
|
||
(gimp_scale_options_constrain_notify): new callback which makes
|
||
the radio buttons a real view on the model again (fixes GUI
|
||
updates on modifier press/release).
|
||
|
||
2004-10-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/plug-in-actions.c (plug_in_actions_update): an image
|
||
doesn't necessarily have a drawable. Handle the case when it doesn't.
|
||
|
||
2004-10-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/app_procs.[ch]
|
||
* app/batch.[ch]
|
||
* app/main.c: added new command-line option "--batch-interpreter"
|
||
that allows to specify the procedure to use to process batch
|
||
commands. Removed the perl-server hack but kept Script-Fu as the
|
||
default for backward compatibility.
|
||
|
||
* docs/gimp.1.in: documented the new option.
|
||
|
||
2004-10-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/file-commands.c (file_revert_confirm_callback):
|
||
removed the code which sets the new image on all contexts where
|
||
the old image was set...
|
||
|
||
* app/display/gimpdisplay-foreach.c (gimp_displays_reconnect):
|
||
...and added it here so it happens for all calls of this function,
|
||
also from the PDB. Fixes bug #154638.
|
||
|
||
2004-10-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimp.def: updated.
|
||
|
||
2004-10-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/brush.pdb: return the mask's bpp and the
|
||
brush's pixmap data if it has one.
|
||
|
||
* tools/pdbgen/pdb/pattern.pdb: cleaned up.
|
||
|
||
* tools/pdbgen/pdb/image.pdb: added $deprecated = 1 to deprecated
|
||
functions even if they are not exported to libgimp any more.
|
||
|
||
* app/pdb/procedural_db.h (struct ProcRecord): added member
|
||
"gboolean deprecated".
|
||
|
||
* tools/pdbgen/app.pl
|
||
* app/xcf/xcf.c: fill it accordingly.
|
||
|
||
* app/plug-in/plug-in-message.c (plug_in_handle_proc_run): warn
|
||
not only for deprecated procedured which are in the compat hach
|
||
table, but also for procedures with deprecated flag set to TRUE.
|
||
|
||
* app/pdb/*_cmds.c
|
||
* libgimp/gimpbrush_pdb.[ch]
|
||
* libgimp/gimppattern_pdb.[ch]: regenerated.
|
||
|
||
* libgimp/gimpbrushmenu.c
|
||
* plug-ins/gfig/gfig-style.c: changed accordingly.
|
||
|
||
2004-10-05 Manish Singh <yosh@gimp.org>
|
||
|
||
* tools/pdbgen/lib.pl: Fix array return value generation when there
|
||
are more args after it.
|
||
|
||
2004-10-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* configure.in: bumped version number to 2.1.7.
|
||
|
||
2004-10-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/lib.pl: put subsequent deprecated prototypes into
|
||
a single #ifndef ... #endif pair.
|
||
|
||
* libgimp/gimpbrushes_pdb.h
|
||
* libgimp/gimpgradients_pdb.h
|
||
* libgimp/gimppalettes_pdb.h
|
||
* libgimp/gimppatterns_pdb.h
|
||
* libgimp/gimptexttool_pdb.h: regenerated.
|
||
|
||
2004-10-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpimage.[ch]: store the time when the image is first
|
||
dirtied.
|
||
|
||
* app/display/gimpdisplayshell-close.c: tell the user what time
|
||
period of changes will be lost when the image is not saved.
|
||
|
||
2004-10-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/brushes.pdb (brushes_get_brush_data)
|
||
* tools/pdbgen/pdb/gradients.pdb (gradients_sample_uniform)
|
||
(gradients_sample_custom) (gradients_get_gradient_data)
|
||
* tools/pdbgen/pdb/patterns.pdb (patterns_get_pattern_data):
|
||
deprecated.
|
||
|
||
* tools/pdbgen/pdb/brush.pdb
|
||
* tools/pdbgen/pdb/gradient.pdb
|
||
* tools/pdbgen/pdb/palette.pdb
|
||
* tools/pdbgen/pdb/pattern.pdb: added replacements for the
|
||
deprecated functions. Removed the silly feature that passing NULL
|
||
as name operates on the current brush, pattern etc.
|
||
|
||
* app/pdb/brush_cmds.c
|
||
* app/pdb/brushes_cmds.c
|
||
* app/pdb/gradient_cmds.c
|
||
* app/pdb/gradients_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* app/pdb/palette_cmds.c
|
||
* app/pdb/pattern_cmds.c
|
||
* app/pdb/patterns_cmds.c
|
||
* libgimp/gimpbrush_pdb.[ch]
|
||
* libgimp/gimpbrushes_pdb.[ch]
|
||
* libgimp/gimpgradient_pdb.[ch]
|
||
* libgimp/gimpgradients_pdb.[ch]
|
||
* libgimp/gimppalette_pdb.c
|
||
* libgimp/gimppattern_pdb.[ch]
|
||
* libgimp/gimppatterns_pdb.[ch]: regenerated.
|
||
|
||
* libgimp/gimpbrushmenu.c
|
||
* libgimp/gimpgradientmenu.c
|
||
* libgimp/gimppatternmenu.c
|
||
* plug-ins/FractalExplorer/Dialogs.c
|
||
* plug-ins/common/gradmap.c
|
||
* plug-ins/common/sample_colorize.c
|
||
* plug-ins/flame/flame.c
|
||
* plug-ins/gfig/gfig-style.c
|
||
* plug-ins/gflare/gflare.c
|
||
* plug-ins/pagecurl/pagecurl.c
|
||
* plug-ins/script-fu/scripts/spyrogimp.scm: changed accordingly.
|
||
|
||
2004-10-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/spheredesigner.c: improved the dialog a bit,
|
||
needs more work.
|
||
|
||
2004-10-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/addborder.scm: simple change to make
|
||
the script work on all image types, not only RGB.
|
||
|
||
2004-10-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* Made 2.1.6 release.
|
||
|
||
2004-10-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/helpbrowser/dialog.c: added a close button. Launch the
|
||
browser with the HTML focused.
|
||
|
||
2004-10-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpwidgets.c (gimp_table_attach_aligned):
|
||
left-justify the label.
|
||
|
||
* libgimpwidgets/gimpdialog.c: if a button with GTK_RESPONSE_HELP
|
||
is being added, hide the automatically added help button.
|
||
|
||
* plug-ins/script-fu/script-fu-interface.c: five buttons are too
|
||
much for the action area. Renamed the About button to Help and
|
||
resurrected the help button in the about dialog as a way to get to
|
||
the actual help pages (pressing F1 will get you there as well).
|
||
|
||
2004-10-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpfiledialog.c: added a help button.
|
||
|
||
2004-10-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/script-fu/siod-wrapper.c (marshall_proc_db_call):
|
||
- check the number of elements of array parameters against
|
||
the actually passed array and spit a proper error message
|
||
instead of trashing the wire. Fixes bug #154266.
|
||
- g_strdup()/g_free() the proc_name so it doesn't get mungled
|
||
by convert_string().
|
||
- added missing implementation of INT16ARRAY return values.
|
||
- cleaned up STRINGARRAY value implementations to work like
|
||
all other array values.
|
||
|
||
2004-10-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-interface.c (script_fu_reset):
|
||
fixed reset for SF_TEXT values.
|
||
|
||
2004-10-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-interface.c (script_fu_interface):
|
||
oops, didn't meant to remove that line.
|
||
|
||
2004-10-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/imagemap/Makefile.am (imagemap_SOURCES): removed pix-data.h.
|
||
|
||
2004-10-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw_area):
|
||
take drawable offsets into account when masking the preview with
|
||
the selection mask.
|
||
|
||
2004-10-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/gimprc.pdb (gimprc_query, gimprc_set): disallow
|
||
the empty string as token. Spotted by Kevin Cozens.
|
||
|
||
* app/pdb/gimprc_cmds.c: regenerated.
|
||
|
||
2004-10-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpaspectpreview.c (gimp_aspect_preview_draw_buffer):
|
||
no need to set bpp before calling gimp_drawable_get_thumbnail_data().
|
||
|
||
2004-10-04 DindinX <dindinx@gimp.org>
|
||
|
||
* libgimp/gimpaspectpreview.c: (gimp_aspect_preview_draw_buffer):
|
||
only apply the effect inside the current selection. This, together
|
||
with my previous commit fixes bug #132194.
|
||
|
||
2004-10-04 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/channel_mixer.c: Ported to GimpAspectPreview. This
|
||
addresses but not totally fixes bug #132194.
|
||
|
||
2004-10-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/config/gimpguiconfig.[ch]
|
||
* app/config/gimprc-blurbs.h: added gimprc option "show-help-button".
|
||
|
||
* app/dialogs/preferences-dialog.c: added a GUI for it.
|
||
|
||
* app/dialogs/file-save-dialog.c
|
||
* app/dialogs/image-new-dialog.c
|
||
* app/dialogs/quit-dialog.c
|
||
* app/display/gimpdisplayshell-close.c
|
||
* app/widgets/gimphelp-ids.h: don't set help-ids on confirmation
|
||
dialogs.
|
||
|
||
* libgimpbase/gimpprotocol.[ch]
|
||
* libgimp/gimp.[ch]: added boolean "show_help_button" to the
|
||
config message.
|
||
|
||
* app/plug-in/plug-in-run.c: pass the new preference to the plug-in.
|
||
|
||
* libgimpwidgets/gimpdialog.[ch]: added new function that allows to
|
||
set whether new dialogs should get a help button added.
|
||
|
||
* app/gui/gui.c
|
||
* libgimp/gimpui.c: call gimp_dialogs_show_help_button() according
|
||
to the gimprc settings.
|
||
|
||
2004-10-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-interface.c (script_fu_about): set
|
||
the help_func again (but not the help_id).
|
||
|
||
2004-10-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-interface.c (script_fu_about):
|
||
enabled line wrapping on labels.
|
||
(script_fu_interface): substitute underscores by hyphens to
|
||
generate the help-id from the procedure name.
|
||
|
||
2004-10-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpbase/gimpwire.c: added assertions to make sure "count" is
|
||
always >= 0. Turns the crash described in bug #154266 into a
|
||
warning plus corrupted wire state :) Real fix (in script-fu) will
|
||
follow. Untabified.
|
||
|
||
2004-10-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimphelpui.c: untabified.
|
||
|
||
(gimp_help_callback): use GIMP_HELP_ID instead of "gimp-help-id".
|
||
|
||
2004-10-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-interface.c (script_fu_interface):
|
||
set a minimum width for the color button again.
|
||
(script_fu_about): don't set help_func and help_id on the about
|
||
dialog.
|
||
|
||
2004-10-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/brush.pdb
|
||
* tools/pdbgen/pdb/gradient.pdb
|
||
* tools/pdbgen/pdb/palette.pdb: disallow the empty string for
|
||
new brushes, gradients and palettes and check the return value
|
||
of gimp_data_factory_data_new(). Cleanup.
|
||
|
||
* app/core/gimpbrushgenerated.c (gimp_brush_generated_new)
|
||
* app/core/gimpgradient.c (gimp_gradient_new)
|
||
* app/core/gimpdatafactory.c (gimp_data_factory_data_new): same
|
||
here. Fixes bug #154264.
|
||
|
||
* app/core/gimpdata.[ch] (gimp_data_set_filename): added boolean
|
||
"deletable" parameter because it's not derivable from "writable".
|
||
|
||
* app/core/gimpdatafactory.c (gimp_data_factory_load_data): need
|
||
to figure "deletable" separately from "writable" to be able to
|
||
delete unsavable stuff in the user-writable data directories.
|
||
Fixes bug #154410.
|
||
|
||
(gimp_data_factory_data_save_single): cleaned up.
|
||
|
||
* app/pdb/brush_cmds.c
|
||
* app/pdb/gradient_cmds.c
|
||
* app/pdb/palette_cmds.c
|
||
* libgimp/gimpbrush_pdb.c
|
||
* libgimp/gimpgradient_pdb.c
|
||
* libgimp/gimppalette_pdb.c: regenerated.
|
||
|
||
2004-10-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/asc2img.scm: a cleaned up version of
|
||
the script contributed by Kevin Cozens (see bug #153900).
|
||
|
||
* plug-ins/script-fu/scripts/predator.scm: applied patch by Kevin
|
||
Cozens that fixes use of the script on original layer (bug #152678).
|
||
|
||
2004-10-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/3d-outline.scm
|
||
* plug-ins/script-fu/scripts/blended-logo.scm
|
||
* plug-ins/script-fu/scripts/camo.scm
|
||
* plug-ins/script-fu/scripts/clothify.scm
|
||
* plug-ins/script-fu/scripts/flatland.scm
|
||
* plug-ins/script-fu/scripts/glossy.scm
|
||
* plug-ins/script-fu/scripts/land.scm
|
||
* plug-ins/script-fu/scripts/predator.scm
|
||
* plug-ins/script-fu/scripts/rendermap.scm
|
||
* plug-ins/script-fu/scripts/ripply-anim.scm
|
||
* plug-ins/script-fu/scripts/speed-text.scm
|
||
* plug-ins/script-fu/scripts/spinning-globe.scm: applied patches
|
||
from Kevin Cozens that define variables before first use (bug
|
||
#153900).
|
||
|
||
2004-10-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpgradientmenu.c: handle allocation > requisition for
|
||
the gradient preview.
|
||
|
||
* plug-ins/script-fu/script-fu-interface.c: added a horizontal
|
||
size group for the left-aligned controls.
|
||
|
||
2004-10-03 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/destripe.c: ported to GimpDrawablePreview.
|
||
|
||
2004-10-03 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/nova.c: ported to GimpAspectPreview.
|
||
|
||
2004-10-03 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/max_rgb.c: ported to GimpAspectPreview.
|
||
|
||
2004-10-03 Michael Schumacher <schumaml@gmx.de>
|
||
|
||
* plug-ins/dbbrowser/Makefile.am
|
||
* plug-ins/script-fu/Makefile.am: moved the libgimpprocbrowser to
|
||
the beginning of LDADD
|
||
|
||
2004-10-03 DindinX <dindinx@gimp.org>
|
||
|
||
* libgimp/gimpaspectpreview.c: limit the size of the preview to 512
|
||
pixels. This prevents plug-ins using gimp_drawable_get_thumbnail_data
|
||
to crash.
|
||
|
||
2004-10-03 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/emboss.c: ported to GimpAspectPreview and made some
|
||
cleanups so this plug-in now use the same naming scheme as other
|
||
plug-ins do.
|
||
|
||
2004-10-03 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/whirlpinch.c: ported to GimpAspectPreview.
|
||
|
||
2004-10-03 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/color.pdb: export the Colorize tool to the PDB.
|
||
Fixes bug #154368.
|
||
|
||
* app/pdb/color_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* libgimp/gimpcolor_pdb.[ch]: regenerated.
|
||
|
||
2004-10-03 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/blinds.c: use a GimpAspectPreview to make the
|
||
preview resizable.
|
||
|
||
2004-10-03 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/ripple.c: Added a preview.
|
||
|
||
2004-10-02 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/polar.c: use a GimpAspectPreview.
|
||
|
||
2004-10-02 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/mapcolor.c: use a GimpAspectPreview and made the
|
||
code much simpler.
|
||
|
||
2004-10-02 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/illusion.c: use a GimpAspectPreview so the preview
|
||
is now resizable.
|
||
|
||
2004-10-02 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/apply_lens.c: added a preview. This plug-in still
|
||
need some work.
|
||
|
||
2004-10-01 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-callbacks.c
|
||
(gimp_display_shell_tool_events): dispatch GDK_Escape to
|
||
GimpTool::key_press().
|
||
|
||
* app/tools/gimpcroptool.c (gimp_crop_tool_key_press)
|
||
* app/tools/gimpimagemaptool.c (gimp_image_map_tool_key_press):
|
||
* app/tools/gimptransformtool.c (gimp_transform_tool_key_press):
|
||
cancel the tool on <Escape>.
|
||
|
||
2004-10-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/dbbrowser/plugin-browser.c: it's Plug-In, not Plugin.
|
||
|
||
2004-10-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimpcroptool.c (crop_response): destroy the info
|
||
dialog instead of hiding it. Fixes session management.
|
||
|
||
2004-10-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimpcroptool.c: unset the highlight from
|
||
crop_response() so it gets called when cropping is cancelled.
|
||
|
||
* app/dialogs/info-dialog.c (info_dialog_show): do what the
|
||
function name says, show the window, but don't present it.
|
||
Fixes bugs #128833 and #138816.
|
||
|
||
2004-10-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* themes/Default/images/stock-frame-64.png: replaced the obtrusive
|
||
drop-shadow by a thin white frame with a subtle shadow. Taken from
|
||
a mockup done by Jimmac.
|
||
|
||
* app/widgets/gimpviewrenderer-frame.c: changed the hardcoded
|
||
offsets for the new frame image :(
|
||
|
||
2004-10-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-callbacks.c: no need to include
|
||
gimpdisplayshell-render.h here.
|
||
|
||
* app/display/gimpdisplayshell-draw.c
|
||
* app/display/gimpdisplayshell-render.[ch]
|
||
|
||
* app/display/gimpdisplayshell.[ch]: added an API to highlight a
|
||
rectangle (specified in image coordinates). Actually it doesn't
|
||
highlight but dims the area outside the rectangle.
|
||
|
||
* app/tools/gimpcroptool.c: use the new functionality to show the
|
||
area to be cropped. Fixes bug #93360.
|
||
|
||
2004-09-30 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-types.h (struct SFScript): renamed
|
||
member "decription" to "menu_path".
|
||
|
||
* plug-ins/script-fu/script-fu-interface.c: changed accordingly.
|
||
|
||
* plug-ins/script-fu/script-fu-scripts.c: ditto. Don't pass the
|
||
menu_path as "blurb" to gimp_install_temp_proc(). Instead,
|
||
pass "help" as "blurb" and nothing as "help".
|
||
|
||
* plug-ins/script-fu/scripts/test-sphere.scm: shortened overly
|
||
long and useless help text.
|
||
|
||
2004-09-30 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/dbbrowser/gimpprocbox.c: don't include
|
||
"libgimp/stdplugins-intl.h".
|
||
|
||
* plug-ins/dbbrowser/gimpprocbrowser.c
|
||
* plug-ins/dbbrowser/plugin-browser.c: use gimp_destroy_paramdefs()
|
||
so we don't leak all param names and descriptions.
|
||
|
||
* plug-ins/dbbrowser/gimpprocview.c: don't show empty rows or
|
||
redundant information (help == blurb for deprecated procedures).
|
||
|
||
2004-09-30 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/dbbrowser/Makefile.am
|
||
* plug-ins/dbbrowser/gimpprocbox.c: new files holding more common
|
||
code from the two browsers.
|
||
|
||
* plug-ins/dbbrowser/gimpprocbrowser.c: use it.
|
||
|
||
* plug-ins/dbbrowser/plugin-browser.c: ditto. Re-enabled sorting
|
||
by all columns in both views. More cleanup.
|
||
|
||
2004-09-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* README: added missing linebreak.
|
||
|
||
* plug-ins/imagemap/imap_about.c (do_about_dialog): should not
|
||
mark email address for translation.
|
||
|
||
2004-09-30 Daniel Egger <degger@fhm.edu>
|
||
|
||
* README: Applied proofreading patch from Jonathan Levi
|
||
<drjlevi@netonecom.net>.
|
||
|
||
2004-09-30 Michael Natterer <mitch@gimp.org>
|
||
|
||
Cleaned up the DB Browser and Plugin Details code and GUI. It's
|
||
not perfect yet but at least they don't look like crap any more.
|
||
Fixes bug #131490.
|
||
|
||
* plug-ins/common/plugin-defs.pl
|
||
* plug-ins/common/plugindetails.c: removed this plugin.
|
||
|
||
* plug-ins/common/.cvsignore
|
||
* plug-ins/common/Makefile.am: regenerated.
|
||
|
||
* plug-ins/dbbrowser/Makefile.am
|
||
* plug-ins/dbbrowser/dbbrowser.c
|
||
* plug-ins/dbbrowser/dbbrowser_utils.[ch]: removed these files.
|
||
|
||
* plug-ins/dbbrowser/gimpprocbrowser.[ch]
|
||
* plug-ins/dbbrowser/gimpprocview.[ch]: new cleaned up files.
|
||
|
||
* plug-ins/dbbrowser/plugin-browser.c: the former plugindetails.
|
||
* plug-ins/dbbrowser/procedure-browser.c: the former dbbrowser.
|
||
|
||
* plug-ins/script-fu/Makefile.am: link against the new library
|
||
libgimpprocbrowser.a
|
||
|
||
* plug-ins/script-fu/script-fu-console.c: changed #includes
|
||
accordingly. Minor cleanup.
|
||
|
||
* tools/pdbgen/pdb/plug_in.pdb (plugins_query): fixed menu_path
|
||
return value. Was broken since the plug-in menu registering
|
||
changes.
|
||
|
||
* app/pdb/plug_in_cmds.c: regenerated.
|
||
|
||
2004-09-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimphelp.c (gimp_help_get_locales): fixed brokeness
|
||
I introduced with my last cleanup.
|
||
|
||
2004-09-29 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/pygimp/plug-ins/gimpfu.py: applied slightly tweaked patch
|
||
from Joao S. O. Bueno, which adds a mutliline text field (PF_TEXT) and
|
||
untabbifies things. Closes bug #153921.
|
||
|
||
* plug-ins/pygimp/plug-ins/gimpplugin.py
|
||
* plug-ins/pygimp/plug-ins/gimpshelf.py
|
||
* plug-ins/pygimp/plug-ins/gimpui.py: Untabbify.
|
||
|
||
2004-09-29 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/pygimp/plug-ins/gtkcons.py: minor tweak to history
|
||
behavior.
|
||
|
||
* plug-ins/pygimp/plug-ins/clothify.py
|
||
* plug-ins/pygimp/plug-ins/foggify.py
|
||
* plug-ins/pygimp/plug-ins/gimpcons.py
|
||
* plug-ins/pygimp/plug-ins/gtkcons.py
|
||
* plug-ins/pygimp/plug-ins/pdbbrowse.py
|
||
* plug-ins/pygimp/plug-ins/shadow_bevel.py
|
||
* plug-ins/pygimp/plug-ins/sphere.py
|
||
* plug-ins/pygimp/plug-ins/whirlpinch.py: Untabbify.
|
||
|
||
2004-09-29 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimpcropoptions.c (gimp_crop_options_gui): plugged a
|
||
tiny memleak spotted by Olivier.
|
||
|
||
2004-09-29 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreview.[ch]
|
||
* libgimpwidgets/gimpwidgets.def: added gimp_preview_draw_buffer().
|
||
|
||
* libgimp/gimpaspectpreview.[ch]
|
||
* libgimp/gimpdrawablepreview.[ch]
|
||
* libgimp/gimpui.def: removed the public draw_buffer API.
|
||
Implement the virtual GimpPreview::draw_buffer method instead.
|
||
|
||
* plug-ins/common/cartoon.c
|
||
* plug-ins/common/deinterlace.c
|
||
* plug-ins/common/despeckle.c
|
||
* plug-ins/common/dog.c
|
||
* plug-ins/common/edge.c
|
||
* plug-ins/common/engrave.c
|
||
* plug-ins/common/exchange.c
|
||
* plug-ins/common/gauss.c
|
||
* plug-ins/common/grid.c
|
||
* plug-ins/common/neon.c
|
||
* plug-ins/common/noisify.c
|
||
* plug-ins/common/oilify.c
|
||
* plug-ins/common/photocopy.c
|
||
* plug-ins/common/plasma.c
|
||
* plug-ins/common/sel_gauss.c
|
||
* plug-ins/common/sharpen.c
|
||
* plug-ins/common/shift.c
|
||
* plug-ins/common/snoise.c
|
||
* plug-ins/common/sobel.c
|
||
* plug-ins/common/spread.c
|
||
* plug-ins/common/struc.c: changed accordingly. Don't pass the
|
||
preview around as GimpDrawablePreview or GimpAspectPreview. It
|
||
should whenever possible be accessed as GimpPreview.
|
||
|
||
2004-09-29 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreview.[ch]
|
||
* libgimpwidgets/gimpscrolledpreview.[ch]
|
||
* libgimpwidgets/gimpwidgets.def: moved the offsets and the
|
||
draw_thumb method back to the GimpPreview class.
|
||
|
||
* libgimp/gimpdrawablepreview.c: changed accordingly.
|
||
|
||
* plug-ins/common/bumpmap.c
|
||
* plug-ins/common/cartoon.c
|
||
* plug-ins/common/deinterlace.c
|
||
* plug-ins/common/despeckle.c
|
||
* plug-ins/common/dog.c
|
||
* plug-ins/common/edge.c
|
||
* plug-ins/common/engrave.c
|
||
* plug-ins/common/exchange.c
|
||
* plug-ins/common/gauss.c
|
||
* plug-ins/common/grid.c
|
||
* plug-ins/common/mblur.c
|
||
* plug-ins/common/neon.c
|
||
* plug-ins/common/noisify.c
|
||
* plug-ins/common/oilify.c
|
||
* plug-ins/common/photocopy.c
|
||
* plug-ins/common/sel_gauss.c
|
||
* plug-ins/common/sharpen.c
|
||
* plug-ins/common/shift.c
|
||
* plug-ins/common/sobel.c
|
||
* plug-ins/common/softglow.c
|
||
* plug-ins/common/spread.c
|
||
* plug-ins/common/struc.c
|
||
* plug-ins/common/unsharp.c
|
||
* plug-ins/common/wind.c: back to using gimp_preview_get_position().
|
||
|
||
* libgimp/gimpregioniterator.c (gimp_rgn_iterator_new): corrected
|
||
gtk-doc comment.
|
||
|
||
2004-09-29 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/snoise.c: Use a GimpAspectPreview here, so the
|
||
preview is resizable.
|
||
|
||
2004-09-29 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpui.def
|
||
* libgimpwidgets/gimpwidgets.def: updated.
|
||
|
||
2004-09-29 DindinX <dindinx@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreview.c
|
||
* libgimpwidgets/gimppreview.h: split this widget into itself (more
|
||
abstract now) and ...
|
||
|
||
* libgimpwidgets/gimpscrolledpreview.c
|
||
* libgimpwidgets/gimpscrolledpreview.h: this widget which also have
|
||
some scrollbars and a nagivation preview.
|
||
|
||
* libgimpwidgets/Makefile.am
|
||
* libgimpwidgets/gimpwidgetstypes.h: changed accordingly.
|
||
|
||
* libgimp/gimpaspectpreview.c
|
||
* libgimp/gimpaspectpreview.h: Added this widget, derived from
|
||
GimpPreview, which has always the same ratio has the given drawable.
|
||
This widget has almost the same api as GimpDrawablePreview, and is
|
||
useful for plug-ins that show the whole (scaled) drawable in their
|
||
preview.
|
||
|
||
* libgimp/gimpdrawablepreview.c
|
||
* libgimp/gimpdrawablepreview.h: GimpDrawablePreview is now derived
|
||
from GimpScrolledPreview.
|
||
|
||
* libgimp/Makefile.am
|
||
* libgimp/gimpui.h
|
||
* libgimp/gimpuitypes.h: changed accordingly.
|
||
|
||
* plug-ins/common/plasma.c: use a GimpAspectPreview.
|
||
|
||
* plug-ins/common/bumpmap.c
|
||
* plug-ins/common/cartoon.c
|
||
* plug-ins/common/deinterlace.c
|
||
* plug-ins/common/despeckle.c
|
||
* plug-ins/common/dog.c
|
||
* plug-ins/common/edge.c
|
||
* plug-ins/common/engrave.c
|
||
* plug-ins/common/exchange.c
|
||
* plug-ins/common/gauss.c
|
||
* plug-ins/common/grid.c
|
||
* plug-ins/common/mblur.c
|
||
* plug-ins/common/neon.c
|
||
* plug-ins/common/noisify.c
|
||
* plug-ins/common/oilify.c
|
||
* plug-ins/common/photocopy.c
|
||
* plug-ins/common/sel_gauss.c
|
||
* plug-ins/common/sharpen.c
|
||
* plug-ins/common/shift.c
|
||
* plug-ins/common/sobel.c
|
||
* plug-ins/common/softglow.c
|
||
* plug-ins/common/spread.c
|
||
* plug-ins/common/struc.c
|
||
* plug-ins/common/unsharp.c
|
||
* plug-ins/common/wind.c: use gimp_scrolled_preview_get_position
|
||
instead of gimp_preview_get_position.
|
||
|
||
2004-09-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimp/gimpregioniterator.[ch]: renamed the "run_mode"
|
||
parameters to "unused" and remode the rum_mode member from the
|
||
private GimpRgbIterator struct.
|
||
|
||
* plug-ins/common/AlienMap2.c
|
||
* plug-ins/common/autostretch_hsv.c
|
||
* plug-ins/common/c_astretch.c
|
||
* plug-ins/common/color_enhance.c
|
||
* plug-ins/common/colorify.c
|
||
* plug-ins/common/colortoalpha.c
|
||
* plug-ins/common/gradmap.c
|
||
* plug-ins/common/mapcolor.c
|
||
* plug-ins/common/max_rgb.c
|
||
* plug-ins/common/noisify.c
|
||
* plug-ins/common/normalize.c
|
||
* plug-ins/common/sample_colorize.c
|
||
* plug-ins/common/scatter_hsv.c
|
||
* plug-ins/common/semiflatten.c
|
||
* plug-ins/common/threshold_alpha.c
|
||
* plug-ins/common/vinvert.c
|
||
* plug-ins/fp/fp.c: made "run_mode" a private variable of run()
|
||
and pass 0 to gimp_rgn_iterate*(). Minor cleanups.
|
||
|
||
2004-09-29 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimp.def
|
||
* libgimp/gimpui.def
|
||
* libgimpwidgets/gimpwidgets.def: updated.
|
||
|
||
2004-09-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/Makefile.am
|
||
* tools/pdbgen/groups.pl: renamed group "gradient_edit" to
|
||
"gradient" and added "brush", "palette" and "pattern" groups.
|
||
|
||
* tools/pdbgen/pdb/gradient_edit.pdb: removed.
|
||
|
||
* tools/pdbgen/pdb/brush.pdb
|
||
* tools/pdbgen/pdb/gradient.pdb
|
||
* tools/pdbgen/pdb/palette.pdb
|
||
* tools/pdbgen/pdb/pattern.pdb: new files containing functions
|
||
which create, duplicate, rename, delete, query and manipulate
|
||
a single brush, pattern etc.
|
||
|
||
* tools/pdbgen/pdb/brushes.pdb
|
||
* tools/pdbgen/pdb/gradients.pdb
|
||
* tools/pdbgen/pdb/palettes.pdb
|
||
* tools/pdbgen/pdb/patterns.pdb: deprecated stuff that is obsolete
|
||
now and simply removed the procedures that were added after 2.0.
|
||
|
||
* app/pdb/gradient_edit_cmds.c
|
||
* libgimp/gimpgradientedit_pdb.[ch]: removed.
|
||
|
||
* app/pdb/brush_cmds.c
|
||
* app/pdb/gradient_cmds.c
|
||
* app/pdb/palette_cmds.c
|
||
* app/pdb/pattern_cmds.c
|
||
* libgimp/gimpbrush_pdb.[ch]
|
||
* libgimp/gimpgradient_pdb.[ch]
|
||
* libgimp/gimppalette_pdb.[ch]
|
||
* libgimp/gimppattern_pdb.[ch]: new files.
|
||
|
||
* app/pdb/brushes_cmds.c
|
||
* app/pdb/gradients_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* app/pdb/palettes_cmds.c
|
||
* app/pdb/patterns_cmds.c
|
||
* libgimp/gimp_pdb.h
|
||
* libgimp/gimpbrushes_pdb.[ch]
|
||
* libgimp/gimpgradients_pdb.[ch]
|
||
* libgimp/gimppalettes_pdb.[ch]
|
||
* libgimp/gimppatterns_pdb.[ch]: regenerated.
|
||
|
||
* app/pdb/Makefile.am
|
||
* libgimp/Makefile.am
|
||
* plug-ins/gfig/gfig-style.c: changed accordingly.
|
||
|
||
2004-09-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/file/gimprecentlist.c (gimp_recent_list_write): don't write
|
||
empty groups.
|
||
|
||
* app/file/gimprecentlist.c: disabled the code for the win32
|
||
platform. It doesn't make much sense there anyway. If someone
|
||
wants to contribute a win32 specific implementation, we'd welcome
|
||
that. A Mac OS X implementation would be nice to have as well.
|
||
|
||
2004-09-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* etc/ps-menurc: updated for GIMP 2.1 by Eric Pierce.
|
||
|
||
2004-09-28 Maurits Rijk <m.rijk@chello.nl>
|
||
|
||
* plug-ins/imagemap/imap_circle.c:
|
||
* plug-ins/imagemap/imap_cmd_gimp_guides.c
|
||
* plug-ins/imagemap/imap_edit_area_info.c
|
||
* plug-ins/imagemap/imap_grid.c
|
||
* plug-ins/imagemap/imap_polygon.c
|
||
* plug-ins/imagemap/imap_rectangle.c
|
||
* plug-ins/imagemap/imap_settings.c: first set of changes to make
|
||
imagemap fully HIG compliant. More to come.
|
||
|
||
2004-09-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/file/gimprecentlist.c: seek to the start of the file before
|
||
calling lockf().
|
||
|
||
2004-09-28 Maurits Rijk <m.rijk@chello.nl>
|
||
|
||
* plug-ins/common/borderaverage.c: added size entry. Fixes #143156
|
||
(Use size entry widget in Borderaverage plug-in)
|
||
|
||
2004-09-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* docs/gimp.1.in: updated name of the splash image.
|
||
|
||
2004-09-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimppalette.c: code review / cleanup.
|
||
|
||
(gimp_palette_delete_entry): don't add "Black" when the last color
|
||
gets removed, a palette can easily live with zero colors.
|
||
|
||
* app/widgets/gimppaletteeditor.c
|
||
(palette_editor_invalidate_preview): also update the entry which
|
||
shows the palette_entry's name.
|
||
|
||
2004-09-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/file/gimprecentlist.c (gimp_recent_list_write_raw): handle
|
||
EINTR while writing.
|
||
|
||
2004-09-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/config/gimpxmlparser.[ch]: added new convenience function
|
||
gimp_xml_parser_parse_fd().
|
||
|
||
* app/file/Makefile.am
|
||
* app/file/gimprecentitem.[ch]
|
||
* app/file/gimprecentlist.[ch]: added an implementation of the
|
||
recent-files spec as found on freedesktop.org. This code is taken
|
||
from libegg and has been edited to fit the GIMP needs.
|
||
|
||
* app/file/file-open.c
|
||
* app/file/file-save.c: update the ~/.recently-used file. Fixes
|
||
bug #131206.
|
||
|
||
2004-09-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontainerbox.c (gimp_container_box_get_preview):
|
||
removed hack which strcmp()s the property name to figure the
|
||
preview's border_width and use the container view's
|
||
preview_border_width instead.
|
||
|
||
2004-09-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimpimagemaptool.c (gimp_image_map_tool_settings_dialog):
|
||
simplified code and removed a compiler warning.
|
||
|
||
2004-09-28 Carol Spears <carol@gimp.org>
|
||
|
||
* data/images/gimp-splash.png there was a white spot that was making
|
||
me crazy. It is gone now.
|
||
|
||
2004-09-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpaction.c (gimp_action_set_proxy): added a hack
|
||
to get rid of the border drawn around thumbnails in the "Open Recent"
|
||
menu.
|
||
|
||
2004-09-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimpimagemaptool.c (gimp_image_map_tool_settings_dialog):
|
||
add a shortcut to the filechooser that points to the user's folder.
|
||
|
||
* app/actions/vectors-commands.c: added a file filter to the SVG
|
||
import dialog.
|
||
|
||
2004-09-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpthumbbox.c (gimp_thumb_box_new): added some
|
||
padding for the shadow frame to avoid scaling the thumbnail.
|
||
|
||
2004-09-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* themes/Default/images/Makefile.am
|
||
* themes/Default/images/stock-frame-64.png: added a stock icon
|
||
that shows a simple drop shadow but could be exchanged for other
|
||
image decorations.
|
||
|
||
* libgimpwidgets/gimpstock.[ch]: register the new icon.
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/gimpviewrenderer-frame.[ch]: new file that holds some
|
||
ugly code to draw a frame around a preview pixbuf.
|
||
|
||
* app/widgets/gimpviewrenderer.[ch]: the frame pixbuf is attached
|
||
to the GimpViewRenderer class so it can be shared by all renderers.
|
||
|
||
* app/widgets/gimpviewrendererimagefile.c: use the new functionality
|
||
to draw a nice frame around imagefile previews.
|
||
|
||
* app/widgets/gimpcontainerbox.c: draw imagefile preview w/o a border.
|
||
|
||
2004-09-27 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/data-commands.c: cleanup.
|
||
|
||
* app/actions/vectors-commands.c
|
||
* app/display/gimpdisplayshell.c
|
||
* tools/pdbgen/pdb/paint_tools.pdb: removed unused #includes.
|
||
|
||
* app/text/gimptext-bitmap.c
|
||
* app/text/gimptext-parasite.c
|
||
* app/text/gimptext-vectors.c
|
||
* app/text/gimptext-xlfd.c
|
||
* app/text/gimptext.c
|
||
* app/text/gimptextlayer-xcf.c: include "text-types.h" instead
|
||
of "text/text-types.h".
|
||
|
||
* app/widgets/gimppatternselect.c: create a GimpPatternFactoryView
|
||
instead of GimpDataFactoryView.
|
||
|
||
* app/pdb/paint_tools_cmds.c: regenerated.
|
||
|
||
2004-09-27 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/brushes-actions.c
|
||
* app/actions/gradients-actions.c
|
||
* app/actions/palettes-actions.c
|
||
* app/actions/patterns-actions.c: made the "foo-edit" actions
|
||
GimpStringActions and pass the identifier of the editor dialog
|
||
to the callback.
|
||
|
||
* app/actions/data-commands.[ch] (data_edit_data_cmd_callback):
|
||
show the editor dialog here instead of calling view->edit_func().
|
||
|
||
* app/dialogs/dialogs-constructors.[ch]: removed the brush,
|
||
gradient and palette edit_funcs.
|
||
|
||
* app/widgets/widgets-types.h: removed typedef GimpDataEditFunc.
|
||
|
||
* app/widgets/gimpdatafactoryview.[ch]: removed the edit_func
|
||
member and parameters and create the edit button unconditionally.
|
||
|
||
* app/widgets/gimpbrushfactoryview.[ch]
|
||
* app/widgets/gimppatternfactoryview.[ch]: changed accordingly.
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/gimpdataselect.[ch]: removed this class, it's not
|
||
needed any longer.
|
||
|
||
* app/widgets/gimpbrushselect.[ch]
|
||
* app/widgets/gimpgradientselect.[ch]
|
||
* app/widgets/gimppaletteselect.[ch]
|
||
* app/widgets/gimppatternselect.[ch]: derive them from GimpPdbDialog
|
||
and follow the edit_func removal.
|
||
|
||
* app/gui/gui-vtable.c (gui_pdb_dialog_new): removed edit_func
|
||
stuff.
|
||
|
||
* app/widgets/gimpcontainereditor.c: minor unrelated cleanup.
|
||
|
||
2004-09-27 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/dialogs-constrcutors.[ch]: renamed some constructors
|
||
for consistency and added a (useless) template grid.
|
||
|
||
* app/dialogs/dialogs.c: make the arrays of GimpDialogFactoryEntries
|
||
more readable by using macros to define them.
|
||
|
||
2004-09-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpimagefile.c: removed conversion to TempBuf.
|
||
Instead implement GimpViewable::get_new_pixbuf by compositing the
|
||
thumbnail on a checkerboard.
|
||
|
||
* app/widgets/gimpviewrenderer.[ch]: renamed the no_view_pixbuf
|
||
struct member to pixbuf.
|
||
(gimp_view_renderer_real_render): try gimp_viewable_get_pixbuf()
|
||
and render the pixbuf before falling back to the TempBuf preview.
|
||
(gimp_view_renderer_render_pixbuf): new function that sets a
|
||
pixbuf for the renderer and flushes the render_buffer.
|
||
|
||
* app/widgets/gimpviewrendererimagefile.c
|
||
(gimp_view_renderer_imagefile_render): render the pixbuf.
|
||
|
||
* app/dialogs/dialogs-constructors.c: create the document history
|
||
dockable with a zero borderwidth.
|
||
|
||
2004-09-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/fileops.pdb (file_load_thumbnail_invoker): use
|
||
the GIMP_CHECK_SIZE_SM define, not the enum value
|
||
GIMP_CHECK_SIZE_SMALL_CHECKS which is 0 (eeek!).
|
||
|
||
* app/pdb/fileops_cmds.c: regenerated.
|
||
|
||
* app/widgets/gimphelp.c (gimp_help_get_locales): minor cleanup.
|
||
|
||
2004-09-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpdataeditor.[ch]: added "data" property.
|
||
|
||
* app/widgets/gimpbrusheditor.c
|
||
* app/widgets/gimpgradienteditor.c
|
||
* app/widgets/gimppaletteeditor.c: pass the current data to
|
||
g_object_new() so we never end up with initially empty editors.
|
||
|
||
2004-09-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpdataeditor.[ch]: added CONSTRUCT_ONLY
|
||
"data-factory" property. Removed gimp_data_editor_construct().
|
||
|
||
* app/widgets/gimpbrusheditor.c
|
||
* app/widgets/gimpgradienteditor.c
|
||
* app/widgets/gimppaletteeditor.c: pass the construct parameters
|
||
to g_object_new().
|
||
|
||
2004-09-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpcolorframe.c: changed label alignment to be more
|
||
HIG conformant and consistent with the rest of the user interface.
|
||
|
||
2004-09-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpdialogfactory.[ch]: added "name", "blurb",
|
||
"stock_id" and "help_id" to struct GimpDialogFactoryEntry and to
|
||
gimp_dialog_factory_dialog_register(). Added typedef
|
||
GimpDialogConstructor which takes a GimpDialogFactoryEntry in
|
||
addition to the parameters GimpDialogNewFunc takes. Added a
|
||
constructor function pointer to GimpDialogFactory which defaults
|
||
to a function that just returns entry->new_func(). Use that
|
||
constructor instead of entry->new_func() for creating
|
||
dialogs. Added public API gimp_dialog_factory_set_constructor().
|
||
|
||
* app/dialogs/dialogs.c: register name, blurb, stock_id and
|
||
help_id for all dockables so all the dialog info lives in one huge
|
||
ugly table now. For the global_toolbox_factory and the
|
||
global_dock_factory, set a constructor which creates a dockable
|
||
around the widget returned by entry->new_func().
|
||
|
||
* app/dialogs/dialogs-constructors.[ch]: don't create the dockable
|
||
in each dialog constructor. Removes tons of code and reduces most
|
||
constructors to a "return gimp_foo_new(...)" one-liner. Got rid of
|
||
all static variables, they were from a time when GimpDialogFactory
|
||
was unable to manage singletons.
|
||
|
||
* app/widgets/gimpbrusheditor.[ch]
|
||
* app/widgets/gimpgradienteditor.[ch]
|
||
* app/widgets/gimppaletteeditor.[ch]: return GtkWidget, not
|
||
GimpDataEditor from gimp_foo_editor_new().
|
||
|
||
* app/widgets/gimpdataeditor.c: minor cleanups.
|
||
|
||
2004-09-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcolordialog.c: moved stuff from new() to init().
|
||
|
||
2004-09-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
Ported GimpNavigationView to use actions for its buttons:
|
||
|
||
* app/menus/menus.c (menus_init): register a <GimpNavigationEditor>
|
||
UI manager containing the "view" action group.
|
||
|
||
* app/actions/actions.c (action_data_get_foo): handle "data" being
|
||
a GimpNavigationEditor.
|
||
|
||
* app/actions/view-actions.c (view_actions): added tooltips for
|
||
the actions used in the editor.
|
||
|
||
(view_actions_update): use action_data_get_display() instead of
|
||
checking the type of "data" manually.
|
||
|
||
* app/widgets/gimpeditor.c (gimp_editor_add_action_button): use
|
||
a GtkToggleButton instead of GimpButton for GtkToggleActions.
|
||
|
||
* app/display/gimpnavigationeditor.[ch]: added a GimpMenuFactory
|
||
parameter to the public constructor and removed all other
|
||
parameters. Simplified gimp_navigation_editor_new_private() and
|
||
use gimp_editor_add_action_button() instead of just add_button()
|
||
for creating the buttons. Made gimp_navigation_view_set_shell()
|
||
private. Update the UI manager when the shell zooms or scrolls.
|
||
|
||
* app/dialogs/dialogs-constructors.c (dialogs_navigation_view_new):
|
||
pass the menu_factory to gimp_navigation_editor_new().
|
||
|
||
Removed #includes which are not needed any more.
|
||
|
||
2004-09-26 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/exchange.c: use the same preview as in all other
|
||
plug-ins.
|
||
|
||
2004-09-25 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/imagemap/imap_stock.c: removed C++ style comment.
|
||
|
||
2004-09-25 Maurits Rijk <m.rijk@chello.nl>
|
||
|
||
* plug-ins/imagemap/imap_stock.[ch]
|
||
* plug-ins/imagemap/Makefile.am
|
||
* plug-ins/imagemap/*.xpm: get rid of all .xpm images
|
||
|
||
* configure.in
|
||
* plug-ins/imagemap/images/*: and add them as .png here
|
||
|
||
* plug-ins/imagemap/imap_browse.c: remove unused include.
|
||
|
||
2004-09-25 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpviewrenderer.h: removed trailing whitespace.
|
||
|
||
2004-09-25 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-close.c: changed mnemonic so that
|
||
you can close an image w/o saving it by using Ctrl-W Alt-W.
|
||
|
||
2004-09-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpimage-qmask.h: added comment about not changing the
|
||
silly "Qmask" string because it is used to identify the Quick Mask
|
||
in the XCF.
|
||
|
||
* app/core/gimpchannel.c: implement GimpViewable::get_description()
|
||
and return "Quick Mask" if it's the Quick Mask.
|
||
|
||
* app/actions/qmask-actions.c
|
||
* app/actions/qmask-commands.c
|
||
* app/core/core-enums.[ch]
|
||
* app/core/gimpimage-qmask.c
|
||
* app/display/gimpdisplayshell.c: s/QuickMask/Quick Mask/.
|
||
|
||
2004-09-25 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/engrave.c: Added a preview and #if'ed out some
|
||
unreachable code.
|
||
|
||
2004-09-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimppickable.[ch]: added new vitrual function
|
||
GimpPickableInterface::get_image()
|
||
|
||
* app/core/gimpdrawable.c
|
||
* app/core/gimpimagemap.c
|
||
* app/core/gimpprojection.[ch]: implement it.
|
||
|
||
2004-09-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcolormapeditor.[ch]
|
||
* app/widgets/gimphistogrameditor.[ch]
|
||
* app/widgets/gimpselectioneditor.[ch]: removed redundant "gimage"
|
||
parameters from public constructors. They are all GimpImageEditor
|
||
widgets which get their image via gimp_docked_set_context() and
|
||
gimp_image_editor_set_image() later anyway. Fixes uglyness as well
|
||
as problems where the editors had an image but no context, causing
|
||
strange behavior in their foo_actions_update() functions.
|
||
|
||
* app/dialogs/dialogs-constructors.c: changed accordingly. Removed
|
||
redundant calls to gimp_dockable_set_context() on newly created
|
||
dockables because they will get a context when added to their
|
||
containers.
|
||
|
||
2004-09-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcolormapeditor.c: moved stuff from
|
||
gimp_colormap_editor_new() to
|
||
gimp_colormap_editor_init(). Untabified.
|
||
|
||
2004-09-25 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/dog.c: made the preview behave like in all other
|
||
plug-ins by using a GimpDrawablePreview. This allowed to remove a
|
||
bunch of complicated code.
|
||
|
||
2004-09-25 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimptemplateeditor.[ch]: added resolution and image
|
||
type information which is usually hidden in the Advanced Options.
|
||
|
||
2004-09-25 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/oilify.c: Added a preview and made some small
|
||
cleanups.
|
||
|
||
2004-09-24 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/config/gimprc-blurbs.h (LAYER_PREVIEW_SIZE_BLURB): try to
|
||
improve the tooltip for the layer-preview-size gimprc setting.
|
||
Addresses bug #153603.
|
||
|
||
2004-09-24 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpimage-undo-push.c (undo_pop_fs_to_layer): factored
|
||
common code out of the UNDO amd REDO cases. Use gimp_drawable_update()
|
||
instead of gimp_viewable_invalidate_preview() so the projection
|
||
gets updated correctly. Fixes bug #149558.
|
||
|
||
* app/core/gimplayer-floating-sel.c (floating_sel_to_layer):
|
||
removed unused variables and their assignments.
|
||
|
||
2004-09-24 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimptemplateeditor.[ch]: added a label that shows
|
||
the pixel size (as in the initial mockup done by Jimmac).
|
||
|
||
2004-09-24 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimpimagemaptool.c
|
||
(gimp_image_map_tool_settings_dialog): set the folder using
|
||
gtk_file_chooser_set_current_folder(), not set_filename().
|
||
|
||
2004-09-24 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/base/curves.[ch]
|
||
* app/tools/gimpcurvestool.c: defined CURVES_NUM_POINTS and use it.
|
||
|
||
* tools/pdbgen/pdb/color.pdb (curves_spline_invoker): unset the
|
||
last control point which got initialized to (255,255) by
|
||
curves_init(). Fixes bug #153635.
|
||
|
||
* app/pdb/color_cmds.c: regenerated.
|
||
|
||
2004-09-24 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/plug-in/plug-in-message.c: removed a linebreak from a
|
||
warning message.
|
||
|
||
2004-09-24 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint/gimpairbrushoptions.c
|
||
* app/paint/gimpcloneoptions.c
|
||
* app/paint/gimpconvolveoptions.c
|
||
* app/paint/gimpdodgeburnoptions.c
|
||
* app/paint/gimperaseroptions.c
|
||
* app/paint/gimpinkoptions.c
|
||
* app/paint/gimppaintoptions.c
|
||
* app/paint/gimppenciloptions.c
|
||
* app/paint/gimpsmudgeoptions.c
|
||
* app/tools/gimpblendoptions.c
|
||
* app/tools/gimpbucketfilloptions.c
|
||
* app/tools/gimpcoloroptions.c
|
||
* app/tools/gimpcolorpickeroptions.c
|
||
* app/tools/gimpcropoptions.c
|
||
* app/tools/gimpflipoptions.c
|
||
* app/tools/gimphistogramoptions.c
|
||
* app/tools/gimpimagemapoptions.c
|
||
* app/tools/gimpmagnifyoptions.c
|
||
* app/tools/gimpmeasureoptions.c
|
||
* app/tools/gimpmoveoptions.c
|
||
* app/tools/gimppaintoptions-gui.c
|
||
* app/tools/gimpselectionoptions.c
|
||
* app/tools/gimptextoptions.c
|
||
* app/tools/gimptransformoptions.c
|
||
* app/tools/gimpvectoroptions.c: code cleanup: untabified and
|
||
trailing whitespace removal, removed empty instance_init()
|
||
funcions, cleaned up variable declarations/initializations.
|
||
|
||
2004-09-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimpairbrushtool.c (gimp_airbrush_tool_register)
|
||
* app/tools/gimppenciltool.c (gimp_pencil_tool_register):
|
||
add GIMP_CONTEXT_GRADIENT_MASK to the tools' context_props because
|
||
these tools use the current gradient. Fixes bug #153584.
|
||
|
||
2004-09-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/Makefile.am
|
||
* app/dialogs/color-dialog.[ch]: removed...
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpcolordialog.[ch]: ...and added as widget.
|
||
|
||
* app/core/gimpmarshal.list: new marshaller VOID__BOXED_ENUM.
|
||
|
||
* app/widgets/widgets-enums.[ch]: new enum GimpColorDialogState.
|
||
|
||
* app/widgets/gimpcolormapeditor.[ch]
|
||
* app/widgets/gimpcolorpanel.[ch]
|
||
* app/widgets/gimpgradienteditor.[ch]
|
||
* app/widgets/gimppaletteeditor.[ch]
|
||
* app/widgets/gimptoolbox-color-area.c
|
||
* app/actions/gradient-editor-commands.c
|
||
* app/actions/view-commands.c: ported to GimpColorDialog. Removes
|
||
a whole bunch of ugly widgets/ -> dialogs/ dependencies.
|
||
|
||
2004-09-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-interface.c: put the text view into
|
||
a scrolled window. Removed "changed" callbacks for GtkEntry and
|
||
GtkTextView. Instead retrieve the final string when the dialog is
|
||
confirmed.
|
||
|
||
* plug-ins/script-fu/scripts/carved-logo.scm
|
||
* plug-ins/script-fu/scripts/chrome-it.scm
|
||
* plug-ins/script-fu/scripts/crystal-logo.scm
|
||
* plug-ins/script-fu/scripts/sota-chrome-logo.scm: use
|
||
gimp-data-directory instead of the deprecated constant
|
||
gimp-data-dir.
|
||
|
||
* plug-ins/script-fu/scripts/mkbrush.scm: unmarked strings for
|
||
translation that I marked yesterday. Won't work unfortunately.
|
||
|
||
2004-09-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/blended-logo.scm: fixed context
|
||
push/pop.
|
||
|
||
2004-09-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-enums.h
|
||
* plug-ins/script-fu/script-fu-interface.c
|
||
* plug-ins/script-fu/script-fu-scripts.c
|
||
* plug-ins/script-fu/siod-wrapper.c: applied a patch by Kevin
|
||
Cozens, based on a patch by Dov Grobgeld. Implements multi-line
|
||
text input in Script-Fu (bug #124394).
|
||
|
||
* plug-ins/script-fu/scripts/test-sphere.scm: test the new SF-TEXT
|
||
parameter.
|
||
|
||
2004-09-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimppixbuf.c (gimp_drawable_get_thumbnail,
|
||
gimp_image_get_thumbnail): use the exported symbols from
|
||
libgimp, not the private _gimp_drawable_thumbnail()
|
||
and _gimp_image_thumbnail() functions.
|
||
|
||
* libgimp/gimp.def: added new symbols, removed
|
||
_gimp_image_thumbnail and _gimp_drawable_thumbnail.
|
||
|
||
2004-09-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/brushes.pdb
|
||
* tools/pdbgen/pdb/gradients.pdb
|
||
* tools/pdbgen/pdb/palettes.pdb
|
||
* tools/pdbgen/pdb/patterns.pdb: removed the foos_set_foo()
|
||
procedures and marked the foos_get_foo() ones as deprecated. For
|
||
brushes, patterns and palettes, added foos_get_foo_info()
|
||
procedures which work like foos_get_foo_data() but return just the
|
||
properties, not the actual data. Allow NULL or "" to be passed
|
||
as name to all functions (use the current brush, pattern etc.
|
||
in this case).
|
||
|
||
* tools/pdbgen/pdb/fonts.pdb: cleanup.
|
||
|
||
* app/pdb/procedural_db.c: added the removed ones to the compat
|
||
hash table.
|
||
|
||
* libgimp/Makefile.am
|
||
* libgimp/gimpbrushes.[ch]
|
||
* libgimp/gimpgradients.[ch]
|
||
* libgimp/gimppalettes.[ch]
|
||
* libgimp/gimppatterns.[ch]: new files with compat functions
|
||
wich call the resp. gimp_context_*() functions.
|
||
|
||
* libgimp/gimp.h: changed accordingly.
|
||
|
||
* app/pdb/brushes_cmds.c
|
||
* app/pdb/gradients_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* app/pdb/palettes_cmds.c
|
||
* app/pdb/patterns_cmds.c
|
||
* libgimp/gimpbrushes_pdb.[ch]
|
||
* libgimp/gimpgradients_pdb.[ch]
|
||
* libgimp/gimppalettes_pdb.[ch]
|
||
* libgimp/gimppatterns_pdb.[ch]: regenerated.
|
||
|
||
* plug-ins/FractalExplorer/Dialogs.c
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-style.[ch]
|
||
* plug-ins/gflare/gflare.c: changed accordingly.
|
||
|
||
2004-09-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/bumpmap.c (bumpmap_dialog): added a GtkPaned for
|
||
packing preview and controls so the controls are resizable again.
|
||
|
||
2004-09-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/3d-outline.scm
|
||
* plug-ins/script-fu/scripts/beveled-pattern-arrow.scm
|
||
* plug-ins/script-fu/scripts/beveled-pattern-bullet.scm
|
||
* plug-ins/script-fu/scripts/beveled-pattern-button.scm
|
||
* plug-ins/script-fu/scripts/beveled-pattern-heading.scm
|
||
* plug-ins/script-fu/scripts/beveled-pattern-hrule.scm
|
||
* plug-ins/script-fu/scripts/blended-logo.scm
|
||
* plug-ins/script-fu/scripts/carve-it.scm
|
||
* plug-ins/script-fu/scripts/carved-logo.scm
|
||
* plug-ins/script-fu/scripts/chip-away.scm
|
||
* plug-ins/script-fu/scripts/chrome-it.scm
|
||
* plug-ins/script-fu/scripts/coffee.scm
|
||
* plug-ins/script-fu/scripts/comic-logo.scm
|
||
* plug-ins/script-fu/scripts/coolmetal-logo.scm
|
||
* plug-ins/script-fu/scripts/crystal-logo.scm
|
||
* plug-ins/script-fu/scripts/frosty-logo.scm
|
||
* plug-ins/script-fu/scripts/glossy.scm
|
||
* plug-ins/script-fu/scripts/hsv-graph.scm
|
||
* plug-ins/script-fu/scripts/land.scm
|
||
* plug-ins/script-fu/scripts/lava.scm
|
||
* plug-ins/script-fu/scripts/mkbrush.scm
|
||
* plug-ins/script-fu/scripts/rendermap.scm
|
||
* plug-ins/script-fu/scripts/select-to-brush.scm
|
||
* plug-ins/script-fu/scripts/select-to-pattern.scm
|
||
* plug-ins/script-fu/scripts/sota-chrome-logo.scm
|
||
* plug-ins/script-fu/scripts/spyrogimp.scm
|
||
* plug-ins/script-fu/scripts/starburst-logo.scm
|
||
* plug-ins/script-fu/scripts/starscape-logo.scm
|
||
* plug-ins/script-fu/scripts/t-o-p-logo.scm
|
||
* plug-ins/script-fu/scripts/test-sphere.scm
|
||
* plug-ins/script-fu/scripts/textured-logo.scm: use the new
|
||
opacity, paint_mode, brush, pattern, gradient, palette and font
|
||
accessors.
|
||
|
||
2004-09-23 Sven Neumann <sven@gimp.org>
|
||
|
||
Converted the last bunch of scripts to the new context API:
|
||
|
||
* plug-ins/script-fu/scripts/[s-z]*.scm
|
||
|
||
2004-09-23 Sven Neumann <sven@gimp.org>
|
||
|
||
Converted more scripts to the new context API:
|
||
|
||
* plug-ins/script-fu/scripts/glossy.scm
|
||
* plug-ins/script-fu/scripts/hsv-graph.scm
|
||
* plug-ins/script-fu/scripts/image-structure.scm
|
||
* plug-ins/script-fu/scripts/perspective-shadow.scm
|
||
* plug-ins/script-fu/scripts/pupi-button.scm
|
||
* plug-ins/script-fu/scripts/rendermap.scm
|
||
* plug-ins/script-fu/scripts/ripply-anim.scm
|
||
|
||
2004-09-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/hsv-graph.scm:
|
||
|
||
* tools/pdbgen/pdb/context.pdb: oops, should probably pop, not
|
||
push a context in gimp_context_pop().
|
||
|
||
* app/pdb/context_cmds.c: regenerated.
|
||
|
||
* plug-ins/script-fu/scripts/mkbrush.scm: don't fiddle with the
|
||
brush description, simply use the name choosen by the user.
|
||
|
||
2004-09-23 Sven Neumann <sven@gimp.org>
|
||
|
||
Converted the next bunch of scripts to the new context API:
|
||
|
||
* plug-ins/script-fu/scripts/[d-n]*.scm: push and pop a context.
|
||
Removed code that used to restore the context values changed by
|
||
the scripts.
|
||
|
||
2004-09-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/plug-in/plug-in-message.c (plug_in_handle_proc_return_priv):
|
||
removed warning about entering a dead code path. That path is not
|
||
dead at all :)
|
||
|
||
2004-09-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/context.pdb: added accessors for the context's
|
||
brush, pattern, gradient, palette and brush. Deprecation of old
|
||
functions will follow. Fixes gimp-context-set-background wrapper.
|
||
Cleanup.
|
||
|
||
* tools/pdbgen/pdb/patterns.pdb
|
||
* libgimp/gimpbrushes.h: minor fixes.
|
||
|
||
* app/pdb/context_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* app/pdb/patterns_cmds.c
|
||
* libgimp/gimpcontext_pdb.[ch]: regenerated.
|
||
|
||
2004-09-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/bumpmap.c (bumpmap_dialog): cosmetics.
|
||
|
||
2004-09-22 Kevin Turner <acapnotic@twistedmatrix.com>
|
||
|
||
* plug-ins/pygimp/gimpfu.py (register): clean up errors in
|
||
parameter checking.
|
||
|
||
2004-09-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/brushes.pdb: removed the opacity and paint_mode
|
||
functions...
|
||
|
||
* tools/pdbgen/pdb/context.pdb: ...and added them here.
|
||
|
||
* app/pdb/procedural_db.c: added them to the pdb_compat hash table.
|
||
|
||
* libgimp/Makefile.am
|
||
* libgimp/gimpbrushes.[ch]: new files with compat functions
|
||
which call the gimp_context_*() functions.
|
||
|
||
* libgimp/gimp.h: changed accordingly.
|
||
|
||
* app/pdb/brushes_cmds.c
|
||
* app/pdb/context_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* libgimp/gimpbrushes_pdb.[ch]
|
||
* libgimp/gimpcontext_pdb.[ch]: regenerated.
|
||
|
||
2004-09-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/Makefile.am
|
||
* tools/pdbgen/groups.pl
|
||
* tools/pdbgen/pdb/palette.pdb: removed the "Palette" pdb group...
|
||
|
||
* tools/pdbgen/pdb/context.pdb: and added its functions to the
|
||
"Context" namespace instead.
|
||
|
||
* app/pdb/Makefile.am
|
||
* app/pdb/palette_cmds.c: removed.
|
||
|
||
* app/pdb/procedural_db.c: added them to the pdb_compat hash table.
|
||
|
||
* libgimp/Makefile.am
|
||
* libgimp/gimppalette_pdb.[ch]: removed.
|
||
|
||
* libgimp/gimppalette.[ch]: new files holding compat functions
|
||
which call gimp_context_*() functions.
|
||
|
||
* libgimp/gimp.h
|
||
* libgimp/gimpui.c: changed accordingly.
|
||
|
||
* app/pdb/context_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* libgimp/gimp_pdb.h
|
||
* libgimp/gimpcontext_pdb.[ch]: regenerated.
|
||
|
||
* plug-ins/MapObject/mapobject_image.c
|
||
* plug-ins/MapObject/mapobject_preview.c
|
||
* plug-ins/common/apply_lens.c
|
||
* plug-ins/common/blinds.c
|
||
* plug-ins/common/borderaverage.c
|
||
* plug-ins/common/checkerboard.c
|
||
* plug-ins/common/colortoalpha.c
|
||
* plug-ins/common/cubism.c
|
||
* plug-ins/common/exchange.c
|
||
* plug-ins/common/film.c
|
||
* plug-ins/common/gif.c
|
||
* plug-ins/common/grid.c
|
||
* plug-ins/common/mapcolor.c
|
||
* plug-ins/common/mblur.c
|
||
* plug-ins/common/mng.c
|
||
* plug-ins/common/mosaic.c
|
||
* plug-ins/common/papertile.c
|
||
* plug-ins/common/png.c
|
||
* plug-ins/common/polar.c
|
||
* plug-ins/common/semiflatten.c
|
||
* plug-ins/common/sinus.c
|
||
* plug-ins/common/sparkle.c
|
||
* plug-ins/common/vpropagate.c
|
||
* plug-ins/common/warp.c
|
||
* plug-ins/common/whirlpinch.c
|
||
* plug-ins/gfig/gfig-style.c
|
||
* plug-ins/gfli/gfli.c
|
||
* plug-ins/ifscompose/ifscompose.c
|
||
* plug-ins/maze/handy.c
|
||
* plug-ins/pagecurl/pagecurl.c
|
||
* plug-ins/pygimp/gimpmodule.c
|
||
* plug-ins/script-fu/scripts/*.scm: changed accordingly.
|
||
|
||
2004-09-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/view-actions.c (view_zoom_actions): mark menu label
|
||
as translatable (bug #153456).
|
||
|
||
2004-09-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/siod-wrapper.c
|
||
* plug-ins/script-fu/scripts/mkbrush.scm
|
||
* plug-ins/script-fu/scripts/select-to-brush.scm
|
||
* plug-ins/script-fu/scripts/select-to-pattern.scm: applied a
|
||
patch from Kevin Cozens that adds constants for the directory
|
||
names exposed by libgimpbase. Fixes bug #153327.
|
||
|
||
2004-09-22 Sven Neumann <sven@gimp.org>
|
||
|
||
Converted the first bunch of Script-Fu to the new context API:
|
||
|
||
* plug-ins/script-fu/scripts/[3a-c]*.scm: push and pop a context.
|
||
Removed code that used to restore the context values changed by
|
||
the scripts.
|
||
|
||
2004-09-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/plug-in/plug-in-proc-frame.[ch] (plug_in_proc_frame_init):
|
||
removed assertion about proc_rec != NULL because that happens
|
||
when query()ing and init()int plug-ins.
|
||
|
||
Replaced "context" by "main_context" plus "context_stack".
|
||
|
||
* app/plug-in/plug-in-context.c: implement plug_in_context_push()
|
||
and plug_in_context_pop().
|
||
|
||
* app/plug-in/plug-in-message.c
|
||
* app/plug-in/plug-in-progress.c: changed accordingly.
|
||
|
||
* tools/pdbgen/pdb/context.pdb: use the return values of
|
||
plug_in_context_push() and _pop().
|
||
|
||
* app/pdb/context_cmds.c: regenerated.
|
||
|
||
* plug-ins/script-fu/scripts/test-sphere.scm: use
|
||
gimp-context-push and gimp-context-pop instead of remembering the
|
||
old values for FG, BG etc.
|
||
|
||
2004-09-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/Makefile.am
|
||
* tools/pdbgen/pdb/context.pdb: new files that will hold context
|
||
related PDB functions.
|
||
|
||
* tools/pdbgen/groups.pl
|
||
* app/pdb/Makefile.am
|
||
* app/pdb/context_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* app/pdb/progress_cmds.c
|
||
* libgimp/gimp_pdb.h
|
||
* libgimp/gimpcontext_pdb.[ch]: (re)generated.
|
||
|
||
* app/plug-in/Makefile.am
|
||
* app/plug-in/plug-in-context.[ch]: new files that will hold code
|
||
that implements a context stack in the plug-in's proc-frame.
|
||
|
||
* app/plug-in/plug-in.[ch]: new function plug_in_get_proc_frame().
|
||
|
||
* app/plug-in/plug-in-message.c
|
||
* app/plug-in/plug-in-progress.c: use the new function instead of
|
||
duplicating it all over the place.
|
||
|
||
2004-09-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/plug-in/Makefile.am
|
||
* app/plug-in/plug-in-proc.[ch]: removed...
|
||
* app/plug-in/plug-in-proc-def.[ch]: ...and added with a new name.
|
||
|
||
* app/plug-in/plug-in-def.[ch]
|
||
* app/plug-in/plug-in-message.[ch]
|
||
* app/plug-in/plug-in-progress.[ch]
|
||
* app/plug-in/plug-in-rc.[ch]
|
||
* app/plug-in/plug-in-run.[ch]
|
||
* app/plug-in/plug-in.[ch]
|
||
* app/plug-in/plug-ins.[ch]
|
||
* app/actions/plug-in-actions.c
|
||
* app/actions/plug-in-commands.c
|
||
* app/file/file-open.[ch]
|
||
* app/file/file-save.[ch]
|
||
* app/file/file-utils.[ch]
|
||
* app/gui/gui-vtable.c
|
||
* app/menus/plug-in-menus.c
|
||
* app/widgets/gimpfiledialog.c
|
||
* app/widgets/gimpfileprocview.c
|
||
* app/widgets/gimppluginaction.c
|
||
* app/xcf/xcf.c
|
||
* tools/pdbgen/pdb/fileops.pdb
|
||
* tools/pdbgen/pdb/plug_in.pdb: changed accordingly plus some
|
||
minor cosmetic cleanups.
|
||
|
||
* app/pdb/fileops_cmds.c
|
||
* app/pdb/plug_in_cmds.c: regenerated.
|
||
|
||
2004-09-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimplayertreeview.c
|
||
(gimp_layer_tree_view_floating_selection_changed): removed the
|
||
hack that was displaying "Floating Selection" instead of the
|
||
floating layer's real name.
|
||
|
||
* app/core/gimplayer.c: implement GimpViewable::get_description()
|
||
instead and special case floating selections with a two-line
|
||
text that contains "Floating Selection".
|
||
|
||
* app/core/gimplayer-floating-sel.c
|
||
* app/core/gimpimage-undo-push.c: emit "name_changed" on the layer
|
||
when it changes its state from floating to normal or vice versa
|
||
so the views can update accordingly.
|
||
|
||
* app/core/gimpselection.c: s/"Selection"/"Floated Layer"/.
|
||
|
||
* app/tools/gimpeditselectiontool.c:
|
||
s/"Floating Layer"/"Floating Selection"/.
|
||
|
||
2004-09-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/plug-in/Makefile.am
|
||
* app/plug-in/plug-in-proc-frame.[ch]: new files containing
|
||
utility functions for initializing/freeing PlugInProcFrames.
|
||
Added the progress stuff to the proc_frame.
|
||
|
||
* app/plug-in/plug-in.[ch]: removed the progress stuff from the
|
||
PlugIn struct and use the new proc_frame utility functions.
|
||
|
||
* app/plug-in/plug-in-message.c
|
||
* app/plug-in/plug-in-progress.c
|
||
* app/plug-in/plug-in-run.c: changed accordingly.
|
||
|
||
2004-09-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
Prepare for enabling private contexts for plug-ins and scripts:
|
||
|
||
* app/plug-in/plug-in.[ch]: removed the "context" member from
|
||
the PlugIn struct and added it to PlugInProcFrame instead.
|
||
|
||
* app/plug-in/plug-in-message.c
|
||
* app/plug-in/plug-in-progress.c
|
||
* app/plug-in/plug-in-run.c: changed accordingly.
|
||
|
||
2004-09-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/bumpmap.c: moved the preview to the left.
|
||
|
||
2004-09-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/plug-in/plug-in-types.h
|
||
* app/plug-in/plug-in.[ch]: added struct PlugInProcFrame which
|
||
contains the ProcRecord, the proc's GMainLoop and its return
|
||
values.
|
||
|
||
Use the same struct for the plug-in's main proc and its
|
||
temp_procs, so we finally have one set of return values per call
|
||
frame, and not just one per plug-in.
|
||
|
||
Added plug_in_proc_frame_push()/pop() and changed
|
||
plug_in_main_loop[_quit]() accordingly.
|
||
|
||
* app/plug-in/plug-in-message.c
|
||
* app/plug-in/plug-in-progress.c
|
||
* app/plug-in/plug-in-run.c: changed accordingly.
|
||
|
||
2004-09-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/text/gimptextlayout.c (gimp_text_get_pango_context):
|
||
workaround Pango bug #143542 (PangoFT2Fontmap leak, see also bug
|
||
#148997). Based on a patch by Robert Ögren.
|
||
|
||
2004-09-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpviewabledialog.c: removed the prelit event box
|
||
from the header frame, use a smaller font for the subtitle,
|
||
removed the separator.
|
||
|
||
* app/dialogs/preferences-dialog.c: removed the prelit event box
|
||
from the header frame. Perhaps we should have subtitles here with
|
||
a more verbose description of the settings page?
|
||
|
||
2004-09-21 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/file-actions.c (file_actions): resolved conflicting
|
||
mnemonics.
|
||
|
||
2004-09-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* data/images/Makefile.am (imagedata_DATA): renamed gimp_splash.png
|
||
to gimp-splash.png.
|
||
|
||
* data/images/gimp-splash.png: new splash, courtesy of Dave Neary.
|
||
|
||
* app/gui/splash.c: look for gimp-splash.png in the users
|
||
directory, then in the systemwide images directory.
|
||
|
||
2004-09-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-server.c: got rid of two the global
|
||
file descriptor sets. Use the client hash-table instead.
|
||
|
||
2004-09-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-server.c: enabled build of the
|
||
Script-Fu server for the Win32 platform using the winsock API.
|
||
|
||
* plug-ins/script-fu/Makefile.am: link with -lwsock32 on Win32.
|
||
|
||
* plug-ins/script-fu/script-fu-console.c
|
||
* plug-ins/script-fu/script-fu.c
|
||
* plug-ins/script-fu/siod-wrapper.c: removed Win32 specific code
|
||
that isn't needed any longer.
|
||
|
||
2004-09-21 Michael Natterer <mitch@gimp.org>
|
||
|
||
For the sake of completeness, added a GUI for the hidden
|
||
"Open as Layer" feature:
|
||
|
||
* app/actions/file-actions.c
|
||
* app/actions/file-commands.[ch]: added "file-open-as-layer"
|
||
action and callback. Abuse the "gimage" field of GimpFileDialog to
|
||
indicate layer opening (it's otherwise unused for file-open).
|
||
|
||
* app/dialogs/file-open-dialog.c: if dialog->gimage is non-NULL,
|
||
open the selected files as layers for that image.
|
||
|
||
* app/widgets/gimphelp-ids.h: added GIMP_HELP_FILE_OPEN_AS_LAYER.
|
||
|
||
* menus/image-menu.xml.in: added it to the menu.
|
||
|
||
2004-09-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/jpeg.c (save_dialog): let the dialog collapse
|
||
with the expander by making it not resizable.
|
||
|
||
2004-09-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-close.c
|
||
(gimp_display_shell_close_dialog): resolved a mnemonics collision.
|
||
|
||
2004-09-21 Dave Neary <bolsh@gimp.org>
|
||
|
||
* plug-ins/common/psd.c: Correctly set overlay, hard light and
|
||
soft light modes from .psd files. Fixes bug #153229.
|
||
|
||
2004-09-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/svg.c (SVG_DEFAULT_RESOLUTION): set to 90dpi as
|
||
a workaround for bug #143300.
|
||
|
||
2004-09-20 Maurits Rijk <m.rijk@chello.nl>
|
||
|
||
* plug-ins/imagemap/imap_cmd_guides.c
|
||
* plug-ins/imagemap/imap_default_dialog.c
|
||
* plug-ins/imagemap/imap_menu.c
|
||
* plug-ins/imagemap/imap_preferences.c
|
||
* plug-ins/imagemap/imap_tools.c: disabled functionality that doesn't
|
||
fully work yet. Bug #136713 now becomes an enhancement request.
|
||
|
||
2004-09-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/bumpmap.c: added tooltips, enabled "Compensate
|
||
for darkening" by default, some minor cleanups.
|
||
|
||
2004-09-20 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/dialogs-constructors.c: removed useless #includes.
|
||
|
||
2004-09-20 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/buffers-commands.c
|
||
* app/actions/file-commands.c
|
||
* app/actions/layers-commands.c
|
||
* app/actions/plug-in-actions.c
|
||
* app/actions/tools-actions.c: removed useless #includes, cleanup.
|
||
|
||
2004-09-20 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/dialogs.[ch] (dialogs_init): added GimpMenuFactory
|
||
parameter and removed inclusion on "menus/menus.h".
|
||
|
||
* app/menus/menus.[ch] (menus_init): added GimpActionFactory
|
||
parameter and removed inclusion of "actions/actions.h".
|
||
|
||
* app/gui/gui.c (gui_restore_callback): pass the factories to the
|
||
above functions.
|
||
|
||
2004-09-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* configure.in: bumped version number to 2.1.6.
|
||
|
||
2004-09-20 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/deinterlace.c: added a preview. Not sure if it is
|
||
really useful...
|
||
|
||
2004-09-20 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/shift.c: added a preview.
|
||
|
||
2004-09-20 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcolorselect.c (gimp_color_select_xy_events):
|
||
removed "case GDK_CONFIGURE" because it's not needed and did
|
||
"break" instead of "return FALSE", causing random color changes
|
||
when resizing and initially showing the widget.
|
||
|
||
2004-09-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* Made 2.1.5 release.
|
||
|
||
2004-09-20 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/Makefile.am (gimp_2_1_LDFLAGS): removed all -u hacks.
|
||
|
||
(gimp_2_1_LDADD)
|
||
(gimp_console_2_1_LDADD): reordered .a files correctly. The core
|
||
seems to be cleaned up enough to have proper dependencies now.
|
||
|
||
2004-09-20 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/channels-commands.c
|
||
* app/actions/vectors-commands.c: removed massive code duplication
|
||
by factoring out the code that creates the "New Channel/Path" and
|
||
"Edit Channel/Path Attributes" dialogs out to utility functions.
|
||
GUI spacing and Code cleanup.
|
||
|
||
* app/actions/layers-commands.c: minor GUI spacing and code
|
||
cleanup.
|
||
|
||
2004-09-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/base/tile-manager.c (tile_manager_get_memsize): count valid
|
||
tiles, not dirty ones.
|
||
|
||
2004-09-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/bumpmap.c: some tweaks to the dialog layout.
|
||
|
||
2004-09-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/qmask-commands.c (qmask_invert_cmd_callback): is a
|
||
GtkRadioAction callback but behaved like a GtkToggleAction
|
||
callback. Fixes bug #152948.
|
||
|
||
2004-09-19 DindinX <dindinx@gimp.org>
|
||
|
||
* plug-ins/common/bumpmap.c: use a GimpDrawablePreview instead of a
|
||
very complicated homemade preview. Many small changes in the code
|
||
too, and some cleanups. I hope I didn't break anything.
|
||
|
||
2004-09-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/tools/gimppaintoptions-gui.c: clean up ugliness introduced
|
||
by my previous commit -- no functional change.
|
||
|
||
2004-09-19 Sven Neumann <sven@gimp.org>
|
||
|
||
Improved undo memory calculation for paint operations (bug #153035):
|
||
|
||
* app/base/tile-manager.[ch] (tile_manager_get_memsize): added a
|
||
"gboolean sparse" parameter to get more accurate results for
|
||
sparse tile-managers.
|
||
|
||
* app/core/gimpbuffer.c
|
||
* app/core/gimpdrawable.c
|
||
* app/core/gimpimage-undo-push.c
|
||
* app/core/gimpimage.c
|
||
* app/core/gimplayer.c
|
||
* app/core/gimpprojection.c: changed accordingly.
|
||
|
||
2004-09-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/Makefile.am (libappdialogs_a_SOURCES): added authors.h.
|
||
|
||
2004-09-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/tools/gimppaintoptions-gui.c: rearrange tool options as
|
||
described in bug #153014.
|
||
|
||
2004-09-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimperrordialog.c (gimp_error_dialog_add): fixed
|
||
handling of too many error messages.
|
||
|
||
2004-09-19 Sven Neumann <sven@gimp.org>
|
||
|
||
Try to make floating selections more obvious:
|
||
|
||
* app/widgets/gimplayertreeview.c
|
||
(gimp_layer_tree_view_floating_selection_changed): always display
|
||
"Floating Selection" as the name for a floating selection.
|
||
|
||
* app/core/gimpselection.c (gimp_selection_float): call the new
|
||
layer "Selection" instead of "Floating Selection". This is what
|
||
will be displayed if the FS is turned into a layer.
|
||
|
||
* app/actions/layers-commands.c (layers_edit_layer_query): don't
|
||
special case floating selections here.
|
||
|
||
* app/core/gimplayer-floating-sel.c: cosmetics.
|
||
|
||
2004-09-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/postscript.c (ps_open): applied a patch by Peter
|
||
Kirchgessner that solves a problem with the recognition of the
|
||
bounding box. Fixes bug #152829.
|
||
|
||
2004-09-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpcolor/gimprgb-parse.c (gimp_rgb_parse_hex): fixed gtk-doc
|
||
comment.
|
||
|
||
2004-09-18 Simon Budig <simon@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcolorhexentry.c: Removed check for len % 3 == 0,
|
||
so that the entry accepts hex colors starting with "#" again.
|
||
Untabbified.
|
||
|
||
2004-09-18 Manish Singh <yosh@gimp.org>
|
||
|
||
* app/Makefile.am: remove LDFLAGS references to now private
|
||
file_open_dialog_show, file_open_location_dialog_show, and
|
||
file_save_dialog_show.
|
||
|
||
2004-09-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/qmask-commands.c
|
||
* libgimpcolor/gimprgb.c (gimp_rgba_distance): just some cleanup.
|
||
|
||
* app/core/gimpimage-qmask.c (gimp_image_set_qmask_color): always
|
||
set gimage->qmask_color regardless of the qmask state.
|
||
|
||
* libgimpwidgets/gimpcolorbutton.c (gimp_color_button_new): set
|
||
the type before setting the color.
|
||
|
||
2004-09-17 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcomponenteditor.c
|
||
(gimp_component_editor_renderer_update): use
|
||
gimp_component_editor_get_iter() instead of duplicating its code.
|
||
|
||
2004-09-17 Simon Budig <simon@gimp.org>
|
||
|
||
* app/widgets/gimpbrusheditor.[ch]: Added a slider for the
|
||
brush spacing to the brush editor. Should make it more obvious
|
||
how to change it.
|
||
|
||
2004-09-17 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimp-edit.c (gimp_edit_paste): based on a patch from
|
||
Joao S. O. Bueno: Ensure that the pasted layer is always within
|
||
the image, if it fits and aligned at top left if it doesn't.
|
||
Fixes bug #142944.
|
||
|
||
2004-09-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* INSTALL: updated.
|
||
|
||
2004-09-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpwidgets.c (gimp_scale_entry_set_logarithmic):
|
||
applied a patch by Joao S. O. Bueno that fixes bug #152820.
|
||
|
||
2004-09-16 Dave Neary <bolsh@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/burn-in-anim.scm: patch from Kevin
|
||
Cozens which reinstates corona. Fixes bug #142282.
|
||
|
||
2004-09-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* configure.in: depend on GLib >= 2.4.5 and GTK+ >= 2.4.4.
|
||
|
||
* app/gui/gui.c: changed accordingly.
|
||
|
||
* app/sanity.c: ditto. Added check for GLib and put each check
|
||
into its own utility function. Enabled #if 0'ed check for
|
||
FreeType >= 6.2.7.
|
||
|
||
* app/widgets/gimpactiongroup.c
|
||
* app/widgets/gimpcursor.c
|
||
* app/widgets/gimpselectiondata.c
|
||
* app/widgets/gimpuimanager.c
|
||
* app/widgets/gimpwidgets-utils.c: removed workarounds for library
|
||
versions we refuse to start with.
|
||
|
||
2004-09-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpdnd.c (gimp_dnd_uri_list_dest_add): reverse
|
||
order of DND dests so "text/uri-list" is preferred again after my
|
||
DND change of 2004-06-29. Fixes dropping of multiple files.
|
||
|
||
2004-09-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcomponenteditor.[ch]: set the viewable
|
||
renderer's "renderer" property to NULL when clearing the
|
||
view to work around bug #149906.
|
||
|
||
2004-09-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpscanconvert.c (VALUE_TO_PIXEL): replaced a bitshift
|
||
with a binary and. Should be unnoticeably faster ;)
|
||
|
||
2004-09-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/pdb/procedural_db.c: removed #if 0'ed code, took assignments
|
||
out of if()-conditions, minor cleanup.
|
||
|
||
2004-09-16 Simon Budig <simon@gimp.org>
|
||
|
||
* app/core/gimpscanconvert.c: Implemented an own rendering
|
||
callback for libart and use it instead of art_gray_svp_aa().
|
||
This now handles non-antialiased scan conversions itself. It
|
||
also basically shows the way to implement a LUT for the
|
||
scan conversion.
|
||
|
||
2004-09-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/quit-dialog.c: removed code that isn't needed any
|
||
longer now that the dialog is a singleton.
|
||
|
||
2004-09-15 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/mblur.c: fix the preview for the zoom blur mode.
|
||
|
||
2004-09-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreviewarea.c
|
||
(gimp_preview_area_[draw|blend|mask]): fixed code that handles
|
||
drawing outside of the preview area.
|
||
|
||
* plug-ins/common/unsharp.c (preview_update): draw the preview
|
||
directly from the pixel region.
|
||
|
||
2004-09-15 Manish Singh <yosh@gimp.org>
|
||
|
||
* modules/controller_linux_input.c: use guint16 instead of __u16.
|
||
Should fix bug #152746.
|
||
|
||
2004-09-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpdrawablepreview.[ch]
|
||
* libgimp/gimpui.def: renamed gimp_drawable_preview_draw() to
|
||
gimp_drawable_preview_draw_buffer() and added a rowstride
|
||
parameter. Added new functions gimp_drawable_preview_get_drawable()
|
||
and gimp_drawable_preview_draw_region().
|
||
|
||
* plug-ins/common/mblur.c: added a preview that uses the
|
||
shadow tiles as the preview buffer and draws using the new
|
||
gimp_drawable_preview_draw_region() API.
|
||
|
||
* plug-ins/common/photocopy.c
|
||
* plug-ins/common/softglow.c: use gimp_drawable_preview_draw_region().
|
||
|
||
* plug-ins/common/cartoon.c
|
||
* plug-ins/common/despeckle.c
|
||
* plug-ins/common/edge.c
|
||
* plug-ins/common/gauss.c
|
||
* plug-ins/common/grid.c
|
||
* plug-ins/common/neon.c
|
||
* plug-ins/common/noisify.c
|
||
* plug-ins/common/sel_gauss.c
|
||
* plug-ins/common/sharpen.c
|
||
* plug-ins/common/sobel.c
|
||
* plug-ins/common/spread.c
|
||
* plug-ins/common/struc.c
|
||
* plug-ins/common/unsharp.c
|
||
* plug-ins/common/wind.c: use gimp_drawable_preview_draw_buffer().
|
||
|
||
2004-09-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimphelp-ids.h: added help IDs for the drawable- and
|
||
vectors-visible and -liked actions as well as for the layer mask
|
||
property action.
|
||
|
||
* app/actions/drawable-actions.c
|
||
* app/actions/vectors-actions.c: use them.
|
||
|
||
* app/actions/layers-actions.c
|
||
* app/actions/layers-commands.[ch]: ditto. Use
|
||
GIMP_STOCK_TRANSPARENCY for all layer opacity actions. Replaced
|
||
"paint_mode" by "mode" in all action and function/variable names
|
||
because this is the layer mode, not a paint mode.
|
||
|
||
* app/actions/channels-commands.c
|
||
* app/actions/layers-commands.c
|
||
* app/actions/vectors-commands.c: set the "activates-default"
|
||
property on the name entry in all "New Foo" and "Edit Foo
|
||
Attributes" dialogs except in the "New Layer" dialog.
|
||
Addresses bug #148026.
|
||
|
||
* menus/image-menu.xml.in: added a (commented out) layer
|
||
properties menu containing all the new actions.
|
||
|
||
2004-09-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/layers-actions.c
|
||
* app/actions/layers-commands.[ch]: added actions and callbacks
|
||
"layers-preserve-transparency" and
|
||
"layers-paint-mode-first,last,previous,next". Update the "active"
|
||
state of the recently added layer mask property actions in
|
||
layers_actions_update().
|
||
|
||
* app/actions/drawable-actions.c
|
||
* app/actions/drawable-commands.[ch]: added actions and callbacks
|
||
for "drawable-visible" and "drawable-linked". Fixes bug #152597.
|
||
|
||
* app/actions/vectors-actions.c
|
||
* app/actions/vectors-commands.[ch]: same here ("vectors-visible"
|
||
and "vectors-linked").
|
||
|
||
* app/widgets/gimplayertreeview.c
|
||
(gimp_layer_tree_view_preserve_button_toggled): flush the image
|
||
so the new actions are updated. Compress preserve_trans undos.
|
||
|
||
* menus/image-menu.xml.in: added the layer mask property actions
|
||
to the Layers/Mask submenu.
|
||
|
||
* menus/layers-menu.xml: reordered the mask property actions
|
||
to have the same order as in the image menu.
|
||
|
||
2004-09-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpcontainertreeview.c
|
||
(gimp_container_tree_view_menu_position): improved the fix for bug
|
||
#152662 and removed trailing whitespace.
|
||
|
||
2004-09-15 Nathan Summers <rock@gimp.org>
|
||
|
||
* app/widgets/gimpcontainertreeview.c
|
||
(gimp_container_tree_view_menu_position): clamp the popup menu's Y
|
||
position to the visible area of the GtkTreeView. Fixes #152662.
|
||
|
||
2004-09-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimpquerybox.c: set the "activates-default"
|
||
property on the entries in all query boxes so hitting "return"
|
||
confirms them. Addresses bug #148026.
|
||
|
||
2004-09-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpbufferview.c: simplified the code which deals
|
||
with the global_buffer's preview. The new buffer view renderer
|
||
does the aspect ratio magic all by itself now.
|
||
|
||
* app/actions/image-commands.h: removed trailing whitespace.
|
||
|
||
2004-09-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpviewrendererbuffer.[ch]: added a view renderer
|
||
which knows how to preserve a GimpBuffer's aspect ratio if the
|
||
view's aspect ratio is different.
|
||
|
||
* app/widgets/gimpviewrenderer-utils.c
|
||
(gimp_view_renderer_type_from_viewable_type): use it for viewables
|
||
of type GimpBuffer. Fixes bug #152531
|
||
|
||
2004-09-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/flarefx.c
|
||
* plug-ins/common/nova.c: embed the preview into a sunken frame
|
||
and put it into the upper left corner of the dialog.
|
||
|
||
2004-09-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/dialogs/dialogs-constructors.[ch]
|
||
* app/dialogs/dialogs.c
|
||
* app/gui/gui.c: let the dialog factory handle the quit dialog
|
||
as singleton. Fixes bug #151914.
|
||
|
||
* app/dialogs/quit-dialog.c: added a warning here. We need a
|
||
container of dirty images for the above change to work correctly.
|
||
|
||
2004-09-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/jpeg.c (save_dialog): make the "Save EXIF data"
|
||
toggle insensitive when no EXIF data is present (bug #140042).
|
||
|
||
* app/display/gimpdisplayshell-close.c: as suggested by the HIG,
|
||
ask the user to save the image when the last display is being
|
||
closed. Addresses some issues raised in bug #106726.
|
||
|
||
2004-09-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/app_procs.c (app_run): install the message handler for the
|
||
"Gimp-Dialogs" domain.
|
||
|
||
2004-09-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/file-commands.c: resurrected file_open_dialog_show()
|
||
and file_save_dialog_show() as private utility functions to get
|
||
rid of code duplication.
|
||
|
||
2004-09-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
Manage the file-save dialog using the dialog factory and stop
|
||
making menu items insensitive while it is open. Fixes bug #81407.
|
||
|
||
* app/dialogs/Makefile.am
|
||
* app/dialogs/file-dialog-utils.[ch]: removed these files.
|
||
|
||
* app/dialogs/file-save-dialog.[ch]: removed functions
|
||
file_save_dialog_show() and file_save_a_copy_dialog_show() and
|
||
changed internal function file_save_dialog_create() to
|
||
file_save_dialog_new().
|
||
|
||
* app/dialogs/dialogs.c
|
||
* app/dialogs/dialogs-constructors.[ch]: made it completely
|
||
managed by the dialog factory.
|
||
|
||
* app/actions/file-commands.c: create it using the dialog
|
||
factory. Attach it to the image so we open only one save
|
||
dialog per image.
|
||
|
||
* app/dialogs/file-open-dialog.c: added precondition checks
|
||
to file_open_dialog_new().
|
||
|
||
2004-09-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/jpeg.c: some code cleanup.
|
||
|
||
2004-09-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/dialogs/file-open-dialog.[ch]: removed function
|
||
file_open_dialog_show() and changed internal function
|
||
file_open_dialog_create() to file_open_dialog_new().
|
||
|
||
* app/dialogs/dialogs.c
|
||
* app/dialogs/dialogs-constructors.[ch]: made it completely
|
||
managed by the dialog factory.
|
||
|
||
* app/actions/file-commands.c: create it using the dialog factory.
|
||
|
||
2004-09-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
* configure.in
|
||
* app/Makefile.am: added new directory app/dialogs and link
|
||
libappdialogs.c into the gimp binary.
|
||
|
||
* app/gui/Makefile.am
|
||
* app/gui/gui-types.h
|
||
* app/gui/gui-vtable.c
|
||
* app/gui/gui.c
|
||
|
||
* app/gui/about-dialog.[ch]
|
||
* app/gui/authors.h
|
||
* app/gui/color-notebook.[ch]
|
||
* app/gui/convert-dialog.[ch]
|
||
* app/gui/dialogs-constructors.[ch]
|
||
* app/gui/dialogs.[ch]
|
||
* app/gui/file-dialog-utils.[ch]
|
||
* app/gui/file-new-dialog.[ch]
|
||
* app/gui/file-open-dialog.[ch]
|
||
* app/gui/file-open-location-dialog.[ch]
|
||
* app/gui/file-save-dialog.[ch]
|
||
* app/gui/grid-dialog.[ch]
|
||
* app/gui/info-dialog.[ch]
|
||
* app/gui/info-window.[ch]
|
||
* app/gui/module-browser.[ch]
|
||
* app/gui/offset-dialog.[ch]
|
||
* app/gui/palette-import-dialog.[ch]
|
||
* app/gui/preferences-dialog.[ch]
|
||
* app/gui/quit-dialog.[ch]
|
||
* app/gui/resize-dialog.[ch]
|
||
* app/gui/resolution-calibrate-dialog.[ch]
|
||
* app/gui/stroke-dialog.[ch]
|
||
* app/gui/tips-dialog.[ch]
|
||
* app/gui/tips-parser.[ch]
|
||
* app/gui/user-install-dialog.[ch]: removed these files...
|
||
|
||
* app/dialogs/Makefile.am
|
||
* app/dialogs/dialogs-types.h
|
||
|
||
* app/dialogs/*.[ch]: ...and added them here. Changed some
|
||
filenames like module-browser -> module-dialog.
|
||
|
||
* app/app_procs.c
|
||
* app/actions/actions-types.h
|
||
* app/actions/actions.c
|
||
* app/actions/dialogs-actions.c
|
||
* app/actions/dialogs-commands.c
|
||
* app/actions/dockable-commands.c
|
||
* app/actions/drawable-commands.c
|
||
* app/actions/edit-commands.c
|
||
* app/actions/file-commands.c
|
||
* app/actions/gradient-editor-commands.c
|
||
* app/actions/image-commands.c
|
||
* app/actions/layers-commands.c
|
||
* app/actions/palettes-commands.c
|
||
* app/actions/select-commands.c
|
||
* app/actions/templates-commands.c
|
||
* app/actions/templates-commands.h
|
||
* app/actions/vectors-commands.c
|
||
* app/actions/view-commands.c
|
||
* app/display/gimpdisplayshell-cursor.c
|
||
* app/display/gimpdisplayshell-title.c
|
||
* app/display/gimpdisplayshell.[ch]
|
||
* app/tools/gimpcroptool.c
|
||
* app/tools/gimpperspectivetool.c
|
||
* app/tools/gimprotatetool.c
|
||
* app/tools/gimpscaletool.c
|
||
* app/tools/gimpsheartool.c
|
||
* app/tools/gimptransformtool.[ch]
|
||
* app/tools/gimpvectortool.c
|
||
* app/widgets/gimpcolormapeditor.[ch]
|
||
* app/widgets/gimpcolorpanel.c
|
||
* app/widgets/gimpgradienteditor.[ch]
|
||
* app/widgets/gimppaletteeditor.[ch]
|
||
* app/widgets/gimptoolbox-color-area.c
|
||
* menus/toolbox-menu.xml.in
|
||
* tools/authorsgen/authorsgen.pl: changed accordingly.
|
||
|
||
2004-09-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
Restore binary compatibility of the wire protocol that was
|
||
broken by the recent GPConfig changes:
|
||
|
||
* libgimpbase/gimpprotocol.[ch] (struct _GPConfig)
|
||
(_gp_config_read)
|
||
(_gp_config_write): argh, we can't use the two bytes padding
|
||
because that's just a binary compatible struct change, but inserts
|
||
two bytes into the byte stream that goes over the wire. Use the
|
||
first two bytes of the former "gdouble gamma" instead.
|
||
|
||
* app/plug-in/plug-in-run.c (plug_in_run)
|
||
* libgimp/gimp.c (gimp_config): changed accordingly.
|
||
|
||
2004-09-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimphelp.c: simulate the behaviour of GNU gettext and
|
||
look at the LANGUAGE environment variable if the locale is not "C".
|
||
|
||
2004-09-13 Simon Budig <simon@gimp.org>
|
||
|
||
* app/tools/gimpcroptool.c: Fix trailing whitespace introduced by me.
|
||
/me hides embarrassed in a corner... :)
|
||
|
||
2004-09-13 Simon Budig <simon@gimp.org>
|
||
|
||
* app/tools/gimpcroptool.c: Fix warnings and coding style.
|
||
|
||
2004-09-12 Nathan Summers <rock@gimp.org>
|
||
|
||
* app/tools/gimpcroptool.c: disable crop and resize buttons while the
|
||
operation is being processed. Fixes #152372.
|
||
|
||
2004-09-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/aa.c (aa_dialog): use a combo box for format
|
||
selection.
|
||
|
||
2004-09-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimppixelrgn.c: fixed gtk-doc comments, removed trailing
|
||
whitespace.
|
||
|
||
2004-09-12 DindinX <david@dindinx.org>
|
||
|
||
* libgimp/gimppixelrgn.c: some more fixes by nomis.
|
||
|
||
2004-09-12 DindinX <david@dindinx.org>
|
||
|
||
* libgimp/gimppixelrgn.c: nomis helped me to make some correction to
|
||
the documentation.
|
||
|
||
2004-09-12 DindinX <david@dindinx.org>
|
||
|
||
* libgimp/gimppixelrgn.c: more documentation.
|
||
|
||
2004-09-11 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/edge.c: added a default value (TRUE) for the
|
||
update_preview toggle.
|
||
|
||
* plug-ins/common/wind.c: ported to GimpPreviewArea, so the preview is
|
||
much more useful now.
|
||
|
||
2004-09-11 DindinX <david@dindinx.org>
|
||
|
||
* libgimp/gimppixelrgn.c: added some gtk-doc documentation to pixel
|
||
region related functions. (work in progress)
|
||
|
||
2004-09-11 Simon Budig <simon@gimp.org>
|
||
|
||
* app/widgets/gimpdialogfactory.[ch]: Added boolean parameter to
|
||
gimp_dialog_factories_toggle to make it possible to ensure a visible
|
||
toolbox.
|
||
|
||
* app/actions/dialogs-commands.c: Use the new parameter to ensure
|
||
toolbox visibility after the last image window closes.
|
||
|
||
* app/display/gimpdisplayshell-callbacks.c: Changed accordingly.
|
||
|
||
Fixes bug #137057 (the discussion is in bug #152285)
|
||
|
||
2004-09-11 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/edge.c: ported to GimpPreviewArea. 100 less lines of
|
||
code and much more features!
|
||
|
||
2004-09-11 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/oilify.c: some code cleanup and small optimisations.
|
||
|
||
2004-09-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/xpm.c (query): fixed spelling.
|
||
|
||
2004-09-10 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/widgets/gimperrorconsole.c: fix typo
|
||
|
||
2004-09-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcolorselect.c: untabified, removed useless
|
||
inclusion of <gdk/gdkkeysyms.h>.
|
||
|
||
2004-09-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcolorselect.c: ported to GimpPreviewArea.
|
||
Destroy the GdkGC in unrealize() instead of in finalize().
|
||
|
||
2004-09-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontainertreeview-dnd.c
|
||
(gimp_container_tree_view_drop_status): always call
|
||
gdk_drag_status() before returning FALSE.
|
||
|
||
(gimp_container_tree_view_drag_motion): never return FALSE, an
|
||
impossible drop location is now reported by calling
|
||
gdk_drag_status() above. Always returning TRUE makes sure
|
||
gimp_container_tree_view_drag_leave() is called unconditionally
|
||
and can remove the scroll_timeout set in drag_motion().
|
||
|
||
Fixes bug #152193 and many other obscure DND crashes caused by the
|
||
scroll_timeout being invoked after the widget is destroyed.
|
||
|
||
2004-09-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/xpm.c: improved PDB blurb and help. Very loosely
|
||
based on a patch attached to bug #151912.
|
||
|
||
2004-09-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw_thumb):
|
||
also handle GRAY and GRAYA thumbnails.
|
||
|
||
* tools/pdbgen/pdb/drawable.pdb
|
||
* tools/pdbgen/pdb/image.pdb: corrected documentation for
|
||
_gimp_drawable_thumbnail() and _gimp_image_thumbnail().
|
||
|
||
* app/pdb/drawable_cmds.c
|
||
* app/pdb/image_cmds.c
|
||
* libgimp/gimpdrawable_pdb.c
|
||
* libgimp/gimpimage_pdb.c: regenerated.
|
||
|
||
2004-09-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreview.c: fixed positioning of the
|
||
navigation marker and handling of motion events.
|
||
|
||
2004-09-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreview.c
|
||
* libgimpwidgets/gimppreviewarea.c: documented new functions.
|
||
|
||
2004-09-09 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpdrawablepreview.c
|
||
* libgimpwidgets/gimppreview.[ch]: added a navigation popup
|
||
similar to the one in the image window. Needs some more work.
|
||
|
||
2004-09-09 DindinX <david@dindinx.org>
|
||
|
||
* libgimpwidgets/gimppreviewarea.c: added a utility function
|
||
gimp_preview_area_queue_draw(), which queue the right part of the
|
||
preview to be redrawn. And use it in all the drawing functions. This
|
||
fix a problem where the preview wasn't updated correctly after a
|
||
resize.
|
||
|
||
2004-09-09 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/cartoon.c
|
||
* plug-ins/common/despeckle.c
|
||
* plug-ins/common/gauss.c
|
||
* plug-ins/common/grid.c
|
||
* plug-ins/common/neon.c
|
||
* plug-ins/common/noisify.c
|
||
* plug-ins/common/photocopy.c
|
||
* plug-ins/common/sel_gauss.c
|
||
* plug-ins/common/sharpen.c
|
||
* plug-ins/common/sobel.c
|
||
* plug-ins/common/softglow.c
|
||
* plug-ins/common/spread.c
|
||
* plug-ins/common/struc.c
|
||
* plug-ins/common/unsharp.c: pack all drawable previews expanding.
|
||
Also did some general cleanups like consistently naming the dialog
|
||
variable "dialog" and the main vbox "main_vbox".
|
||
|
||
2004-09-09 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreview.[ch]: right-align the preview for RTL
|
||
layouts.
|
||
|
||
2004-09-09 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreviewarea.[ch]: allow to set a maximum size
|
||
and center the preview area if its allocation extends the maximum.
|
||
|
||
* libgimpwidgets/gimppreview.[ch]: derive from GtkVBox, moved the
|
||
toggle button out of the table and put the table into an aspect
|
||
frame. Added an API to set the preview boundaries. Set the maximum
|
||
size of the GimpPreviewArea from that function.
|
||
|
||
* libgimpwidgets/gimpwidgets.def: added new entries.
|
||
|
||
* libgimp/gimpdrawablepreview.c: use gimp_preview_set_bounds().
|
||
|
||
* plug-ins/common/gauss.c: pack the preview widget so that it
|
||
resizes with the dialog.
|
||
|
||
2004-09-09 DindinX <david@dindinx.org>
|
||
|
||
* libgimpwidgets/gimppreviewarea.c (gimp_preview_area_blend)
|
||
(gimp_preview_area_mask): optimized the case where both buffers have
|
||
the same alpha for a given pixel.
|
||
|
||
2004-09-09 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpviewrendererbrush.c
|
||
* app/widgets/gimpviewrendererdrawable.c
|
||
* app/widgets/gimpviewrenderergradient.c
|
||
* app/widgets/gimpviewrendererimage.c
|
||
* app/widgets/gimpviewrendererimagefile.c
|
||
* app/widgets/gimpviewrendererlayer.c
|
||
* app/widgets/gimpviewrenderervectors.c: purely cosmetic cleanup.
|
||
|
||
2004-09-09 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimppdbdialog.c (gimp_pdb_dialog_constructor): use
|
||
g_type_name(dialog_type) instead of just "pdb dialog" as name for
|
||
the dialog's private context.
|
||
|
||
2004-09-09 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/gui/convert-dialog.[ch] (convert_dialog_new): changed
|
||
GimpDisplay* parameter to GimpProgress* because that's what it's
|
||
used for.
|
||
|
||
* app/actions/image-commands.c (image_convert_cmd_callback):
|
||
changed accordingly.
|
||
|
||
* app/gui/convert-dialog.c: massively cleaned up internals. Use a
|
||
GimpViewableButton + GimpContainerEntry combo as in text options
|
||
for selecting the custom palette. Use a filtered container which
|
||
contains only palettes with a maximum of 256 colors.
|
||
Fixes bug #136574
|
||
|
||
2004-09-09 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/gui/file-open-location-dialog.[ch]: changed
|
||
file_open_location_dialog_show() to
|
||
file_open_location_dialog_new() and return the dialog.
|
||
|
||
* app/gui/dialogs.c
|
||
* app/gui/dialogs-constructors.[ch]: added a constructor for it
|
||
and let the dialog factory manage it entirely.
|
||
|
||
* app/actions/file-commands.c
|
||
(file_open_location_dialog_cmd_callback): use the dialog factory
|
||
to create it.
|
||
|
||
2004-09-09 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpdialogfactory.c
|
||
(gimp_dialog_factory_dialog_new_internal): renamed parameter
|
||
"gboolean raise_if_found" to "return_existing" and added
|
||
additional parameter "gboolean present".
|
||
|
||
(gimp_dialog_factory_dialog_new)
|
||
(gimp_dialog_factory_dialog_raise)
|
||
(gimp_dialog_factory_dockable_new): pass both parameters (passing
|
||
"present" as "raise_if_found" was not quite correct).
|
||
|
||
2004-09-08 DindinX <david@dindinx.org>
|
||
|
||
* libgimpwidgets/gimppreviewarea.c: fixed a stupid typo.
|
||
|
||
2004-09-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreviewarea.c (gimp_preview_area_fill):
|
||
optimized solid color fills.
|
||
|
||
2004-09-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreviewarea.c: factored out common code.
|
||
Reduced indentation level by closing a switch earlier.
|
||
|
||
2004-09-08 DindinX <david@dindinx.org>
|
||
|
||
* libgimpwidgets/gimppreviewarea.c: (gimp_preview_area_blend)
|
||
use gimp_preview_area_draw when the opacity is 0 or 255, instead of
|
||
duplicating code.
|
||
|
||
2004-09-07 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpwidgets.def: added new entries.
|
||
|
||
* libgimpwidgets/test-preview-area.c: fit output into 80 columns.
|
||
|
||
* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw): some
|
||
code cleanup.
|
||
|
||
2004-09-07 DindinX <david@dindinx.org>
|
||
|
||
* libgimpwidgets/test-preview-area.c: added some tests for
|
||
gimp_preview_area_blend() and gimp_preview_area_mask().
|
||
|
||
2004-09-07 DindinX <david@dindinx.org>
|
||
|
||
* libgimpwidgets/gimppreviewarea.c
|
||
* libgimpwidgets/gimppreviewarea.h: added two functions:
|
||
gimp_preview_area_blend() to draw the blending of two buffers with
|
||
an opacity parameter, and gimp_preview_area_mask() to draw the
|
||
blending of two buffers, with a mask buffer. The code still needs some
|
||
polish, though.
|
||
|
||
* libgimp/gimpdrawablepreview.c
|
||
* libgimp/gimpdrawablepreview.h: use gimp_preview_area_mask() in
|
||
gimp_drawable_preview_draw(), so the previews are now much more
|
||
accurate (respecting the selection, if any).
|
||
|
||
Also made the buf parameter of gimp_drawable_preview_draw() a pointer
|
||
to constants.
|
||
|
||
2004-09-07 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-draw.c
|
||
(gimp_display_shell_draw_grid): #define the constant crosshair
|
||
size for the INTERSECTION grid style instead of using an eeky
|
||
"const gint".
|
||
|
||
2004-09-07 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/gui/dialogs.c (toplevel_entries): added a foreign entry
|
||
"gimp-file-open-loaction-dialog".
|
||
|
||
* app/gui/file-open-location-dialog.c: register the dialog
|
||
with the toplevel dialog factory so it remembers its position.
|
||
|
||
2004-09-07 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/context-actions.c
|
||
* app/actions/context-commands.[ch]: applied a heavily modified
|
||
patch from David Gowers which adds actions to modify the context's
|
||
paint_mode. Fixes bug #151471.
|
||
|
||
* menus/image-menu.xml.in: added them to the (commentd out)
|
||
"Context" submenu.
|
||
|
||
2004-09-07 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/edge.c: indentation and whitespace cleanup.
|
||
|
||
* plug-ins/common/struc.c: minor coding style issues.
|
||
|
||
2004-09-07 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/xwd.c (query): applied patch from Alan Horkan
|
||
which improves the blurb and help texts. Fixes bug #151912.
|
||
|
||
Unrelated: did coding style / indentation cleanup in the whole file.
|
||
|
||
2004-09-07 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri):
|
||
simplified the code that selects an image file by its URI.
|
||
|
||
2004-09-07 Simon Budig <simon@gimp.org>
|
||
|
||
* app/widgets/gimpviewrendererbrush.c: Added an indicator for
|
||
generated brushes. Pretty straightforward, suggestions for
|
||
improvements are welcome.
|
||
|
||
2004-09-06 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/struc.c: added a preview.
|
||
|
||
2004-09-06 Simon Budig <simon@gimp.org>
|
||
|
||
* app/tools/gimpcroptool.c: reordered info_dialog_hide() and
|
||
crop_tool_crop_image(), which avoids the repeated popping up
|
||
of the info dialog and avoids a crash.
|
||
|
||
Fixes bug #151712
|
||
|
||
2004-09-05 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/cartoon.c: use gimp_preview_invalidate() where
|
||
appropriate.
|
||
|
||
* plug-ins/common/photocopy.c: Added a preview.
|
||
|
||
2004-09-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* configure.in: bumped version number to 2.1.5.
|
||
|
||
* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): select
|
||
the image file, not only the folder it lives in. Fixes bug #151638.
|
||
|
||
2004-09-05 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/cartoon.c: Added a preview.
|
||
|
||
2004-09-05 Simon Budig <simon@gimp.org>
|
||
|
||
* plug-ins/common/autocrop.c: fix handling of layers with an
|
||
offset. Resize the image before cropping when the covered area
|
||
of a layer is partially outside the image area. Make math more
|
||
comprehensible.
|
||
|
||
2004-09-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/convmatrix.c
|
||
* plug-ins/common/smooth_palette.c
|
||
* plug-ins/flame/flame.c: renamed functions from doit() to
|
||
something less silly.
|
||
|
||
2004-09-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* Made 2.1.4 release.
|
||
|
||
2004-09-05 Simon Budig <simon@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/image.pdb: improved documentation for
|
||
gimp_image_resize_to_layers
|
||
|
||
* libgimp/gimp.def: added gimp_image_resize_to_layers
|
||
|
||
* app/pdb/image_cmds.c
|
||
* libgimp/gimpimage_pdb.c: regenerated
|
||
|
||
2004-09-05 Simon Budig <simon@gimp.org>
|
||
|
||
* app/core/gimpimage-resize.[ch]: Implement function to resize
|
||
the image to contain all layers completely. Untabified.
|
||
|
||
* app/actions/image-actions.c
|
||
* app/actions/image-commands.[ch]
|
||
* app/widgets/gimphelp-ids.h
|
||
* menus/image-menu.xml.in: Make it available in the GUI.
|
||
|
||
* tools/pdbgen/pdb/image.pdb: Make it available in the PDB.
|
||
|
||
* app/pdb/image_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* libgimp/gimpimage_pdb.[ch]: regenerated.
|
||
|
||
2004-09-04 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/noisify.c: ported to GimpDrawablePreview.
|
||
|
||
2004-09-04 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* libgimp/gimp.def
|
||
* libgimpbase/gimpbase.def
|
||
* libgimpwidgets/gimpwidgets.def: added the check(erboard) related
|
||
entries
|
||
|
||
2004-09-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreviewarea.[ch]: pass a GdkEventButton to
|
||
gimp_preview_area_menu_popup().
|
||
|
||
* libgimpwidgets/gimppreview.c: implement GtkWidget::popup_menu().
|
||
|
||
2004-09-04 DindinX <david@dindinx.org>
|
||
|
||
* libgimpwidgets/gimppreview.c: Changed the way we attach the preview
|
||
area frame to the table so very small drawables don't cause a
|
||
malicious bug.
|
||
|
||
2004-09-04 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/sel_gauss.c: ported to GimpDrawablePreview.
|
||
|
||
2004-09-04 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/sharpen.c: ported to GimpDrawablePreview.
|
||
|
||
2004-09-03 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreviewarea.[ch]: added
|
||
gimp_preview_area_menu_popup(). Not completely finished yet...
|
||
|
||
* libgimpwidgets/gimppreview.c: use the new function.
|
||
|
||
2004-09-03 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_set_drawable):
|
||
take care of setting the colormap for indexed drawables.
|
||
|
||
* libgimpwidgets/gimppreview.c (gimp_preview_area_event): pan with
|
||
the first mouse button only. We will need the other buttons.
|
||
|
||
2004-09-03 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/grid.c: ported to GimpDrawablePreview.
|
||
|
||
2004-09-03 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/plasma.c (plasma_dialog): left-align the preview.
|
||
|
||
* plug-ins/common/grid.c (dialog): pack the preview as in other
|
||
plug-in dialogs and embed it into a GtkFrame.
|
||
|
||
2004-09-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpdevicestatus.c: removed "Configure input
|
||
devices" button. Fixes bug #150177.
|
||
|
||
2004-09-03 Simon Budig <simon@gimp.org>
|
||
|
||
* app/gui/info-window.c: Applied modified patch by Kevin Cozens
|
||
that implements a "Comments" tab in the image info dialog.
|
||
|
||
Fixes bug #151719.
|
||
|
||
2004-09-03 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreviewarea.c (CHECK_COLOR): swapped light
|
||
and gray checks to get a checkerboard that matches the image window.
|
||
|
||
2004-09-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpbase/gimpprotocol.h (struct _GPConfig): replaced the
|
||
never used "gdouble gamma" with 8 reserved gint8 and stuffed two
|
||
gint8 behind "gint8 show_tool_tips" where they fit in in a binary
|
||
compatible way due to 32bit aligning of the following "gint32
|
||
min_colors". Use the latter ones for "check_size" and
|
||
"check_type".
|
||
|
||
* libgimpbase/gimpprotocol.c (_gp_config_read,write): changed
|
||
accordingly to pass the new stuff over the wire.
|
||
|
||
* app/plug-in/plug-in-run.c: ditto. Pass the transpareny values
|
||
from GimpDisplayConfig to plug-ins.
|
||
|
||
* libgimp/gimp.[ch] (gimp_config): remember the new config values.
|
||
(gimp_check_size,type): new functions returning the new config values.
|
||
|
||
* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_init):
|
||
use the new values to configure preview->area accordingly.
|
||
|
||
2004-09-03 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpbase/gimpchecks.h
|
||
* libgimpbase/gimplimits.h: moved check size and check color
|
||
defines. It makes a lot more sense to keep them in gimpchecks.h.
|
||
|
||
* libgimpbase/gimpchecks.c (gimp_checks_get_shades): documented.
|
||
|
||
* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw):
|
||
added a sanity check so we don't crash if the drawable pointer
|
||
should ever be NULL here.
|
||
|
||
2004-09-02 Helvetix Victorinox <helvetix@gimp.org>
|
||
|
||
* app/composite/gimp-composite-*test.c: a regression test now
|
||
iterates over 8388625 pixels per pass.
|
||
|
||
* app/composite/gimp-composite-mmx.c
|
||
* app/composite/gimp-composite-sse.c
|
||
* app/composite/gimp-composite-sse2.c:
|
||
Ensured that a clobbered condition code register is reflected in
|
||
the clobbered register list for each asm() statement.
|
||
This should FIX bug #147013.
|
||
|
||
2004-09-03 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpbase/Makefile.am
|
||
* libgimpbase/gimpchecks.[ch] added gimp_checks_get_shades().
|
||
|
||
* app/base/temp-buf.c
|
||
* app/display/gimpdisplayshell-render.c
|
||
* libgimpwidgets/gimppreviewarea.c: use the new function instead
|
||
of replicating these numbers in three different places.
|
||
|
||
2004-09-03 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/gimpressionist/*.c: made the code much more readable by
|
||
applying the gimp's coding standard (intentation, space, etc.), and
|
||
remove the GTK_DISABLE_DEPRECATED warnings, since these files don't use
|
||
any deprecated stuff anymore.
|
||
|
||
2004-09-02 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* libgimp/gimpui.def
|
||
* libgimpbase/gimpbase.def
|
||
* libgimpwidgets/gimpwidgets.def: added the preview and progress
|
||
related entries
|
||
|
||
2004-09-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/neon.c
|
||
* plug-ins/common/noisify.c
|
||
* plug-ins/common/sobel.c
|
||
* plug-ins/common/softglow.c
|
||
* plug-ins/common/spread.c
|
||
* plug-ins/common/unsharp.c: fixed various coding style and naming
|
||
issues and added some missing signal connections to update the new
|
||
previews.
|
||
|
||
2004-09-02 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/despeckle.c: don't assume the preview has always the
|
||
same size, and do the memory allocation in preview_update(). As a side
|
||
effect, this fix a segfault :-). Also save the preview toggle state
|
||
between invocations.
|
||
|
||
2004-09-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-render.c (check_combos): light and
|
||
dark check color were swapped for GIMP_CHECK_TYPE_GRAY_CHECKS.
|
||
|
||
* libgimpwidgets/gimppreviewarea.[ch]: added "check-size" and
|
||
"check-type" properties and draw the checkerboard accordingly.
|
||
|
||
2004-09-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/base/base-enums.[ch]
|
||
* libgimpbase/gimpbaseenums.[ch]: moved GimpCheckSize and
|
||
GimpCheckType enums to libgimpbase. Correctly prefix the enum
|
||
values.
|
||
|
||
* app/base/temp-buf.c
|
||
* app/config/gimpdisplayconfig.c
|
||
* app/display/gimpdisplayshell-render.c
|
||
* app/pdb/fileops_cmds.c
|
||
* tools/pdbgen/pdb/fileops.pdb: changed accordingly.
|
||
|
||
2004-09-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-interface.c (script_fu_ok)
|
||
* plug-ins/script-fu/script-fu-scripts.c (script_fu_script_proc):
|
||
use a GString for assembling the commands string instead of
|
||
g_sprintf()ing into a buffer. Removes the need for a separate loop
|
||
over all args to determine the buffer's length and makes the
|
||
remaining code smaller and more readable.
|
||
|
||
2004-09-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreview.[ch]: made gimp_preview_draw() public,
|
||
added some gtk-doc comments.
|
||
(gimp_preview_toggle_callback): immidiately invalidate the preview.
|
||
|
||
* plug-ins/common/gauss.c (gauss): fixed (and simplified) handling
|
||
of zero radii by using the new GimpPreview API.
|
||
|
||
2004-09-01 Helvetix Victorinox <helvetix@gimp.org>
|
||
|
||
* app/composite/gimp-composite-mmx.[ch]: Added
|
||
gimp_composite_addition_va8_va8_va8_mmx().
|
||
|
||
* app/composite/make-installer.py: Regression tests now include
|
||
printing the image type for each test.
|
||
|
||
* app/composite/gimp-composite-mmx-test.c
|
||
* app/composite/gimp-composite-regression.c
|
||
* app/composite/gimp-composite-sse-test.c
|
||
* app/composite/gimp-composite-sse2-test.c
|
||
* app/composite/gimp-composite-x86.h: regenerated.
|
||
|
||
2004-09-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/borderaverage.c
|
||
* plug-ins/common/checkerboard.c
|
||
* plug-ins/common/diffraction.c
|
||
* plug-ins/common/illusion.c
|
||
* plug-ins/common/polar.c
|
||
* plug-ins/common/ripple.c
|
||
* plug-ins/common/spread.c
|
||
* plug-ins/common/video.c: don't pass run_mode to
|
||
gimp_rgn_iterator_new(), it's unused. Removes the need for it being
|
||
a global variable.
|
||
|
||
2004-09-01 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplay.c
|
||
* app/widgets/gimpprogressdialog.c: gracefully handle progress
|
||
calls after the widget is destroyed. Re-fixes bug #150194.
|
||
|
||
2004-09-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpdrawablepreview.[ch]
|
||
* libgimpwidgets/gimppreview.[ch]: always show the "Preview" check
|
||
button. Simplified the preview APIs, moved the "size" style
|
||
property to the GimpPreview class.
|
||
|
||
* etc/gtkrc: changed the example accordingly.
|
||
|
||
* plug-ins/common/despeckle.c
|
||
* plug-ins/common/gauss.c
|
||
* plug-ins/common/neon.c
|
||
* plug-ins/common/sobel.c
|
||
* plug-ins/common/softglow.c
|
||
* plug-ins/common/spread.c
|
||
* plug-ins/common/unsharp.c: follow change in GimpDrawablePreview API.
|
||
|
||
2004-09-01 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-types.h (struct SFOption): changed
|
||
"guint history" to "gint history".
|
||
|
||
* plug-ins/script-fu/script-fu-interface.c: added callbacks for
|
||
string entries and combo boxes and connect *all* widgets to callbacks.
|
||
|
||
(script_fu_ok): don't touch the widgets at all but get the values
|
||
directly now that the callbacks correctly write them to their
|
||
structs.
|
||
|
||
(script_fu_reset): don't copy the default values manually but
|
||
simply set the default values on the widgets; their callbacks will
|
||
do the rest.
|
||
|
||
* plug-ins/script-fu/script-fu-scripts.c (script_fu_add_script):
|
||
added some line breaks and spaces to make it more readable.
|
||
|
||
2004-09-01 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimp/Makefile.am
|
||
* libgimp/gimpui.h
|
||
* libgimp/gimpuitypes.h
|
||
* libgimp/gimpprogressbar.[ch]: new widget GimpProgressBar which
|
||
automatically redirects any progress calls to itself while
|
||
it exists.
|
||
|
||
* plug-ins/script-fu/script-fu-interface.c: removed all progress
|
||
callbacks and simply use a GimpProgressBar.
|
||
|
||
2004-09-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreview.[ch]: set a busy cursor while the
|
||
preview is being recalculated.
|
||
|
||
* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw_original):
|
||
do nothing if there's no drawable.
|
||
|
||
2004-09-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreviewarea.c (CHECK_COLOR): oops, swapped x
|
||
and y variables.
|
||
|
||
* libgimpwidgets/gimppreview.c: some minor changes, mainly cleanup.
|
||
|
||
2004-09-01 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/pygimp/gimpfu.py
|
||
* plug-ins/pygimp/gimpmodule.c: Hacked up support for the new
|
||
progress interface. Emphasis on hacked.
|
||
|
||
* plug-ins/pygimp/gimpmodule.c: Wrapped gimp_extension_enable(). Minor
|
||
cleanups.
|
||
|
||
* plug-ins/pygimp/pygimp-image.c
|
||
* plug-ins/pygimp/pygimp-tile.c: Minor cleanups.
|
||
|
||
2004-08-31 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/pygimp/plug-ins/gimpcons.py
|
||
* plug-ins/pygimp/plug-ins/pdbbrowse.py: remove deprecated mainloop
|
||
calls.
|
||
|
||
2004-09-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpdrawablepreview.c: increased default preview size to
|
||
150 pixels. Added a border of 2 pixels around the bounding box of
|
||
the selection.
|
||
|
||
* libgimpwidgets/gimppreview.[ch]: only show the GDK_FLEUR cursor
|
||
if there's something to pan. Set the correct page size on the
|
||
scrollbar adjustments.
|
||
|
||
2004-09-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreviewarea.[ch]: added new function
|
||
gimp_preview_area_set_offsets().
|
||
|
||
* libgimpwidgets/gimppreview.c: use the new function to let the
|
||
checkerboard scroll with the preview.
|
||
|
||
2004-09-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreview.[ch]: delay the emission of the
|
||
"invalidated" signal using a timeout. Removed hack that used to
|
||
invalidate the preview on button-release.
|
||
|
||
* plug-ins/common/unsharp.c: no need to fiddle with the slider
|
||
update policies any longer.
|
||
|
||
2004-09-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpdialogfactory.[ch]: added a boolean parameter to
|
||
gimp_dialog_factory_dialog_new() to let the caller decide whether
|
||
the window should be presented or not.
|
||
|
||
* app/actions/dialogs-commands.c
|
||
* app/actions/image-commands.c
|
||
* app/actions/templates-commands.c
|
||
* app/gui/gui-vtable.c
|
||
* app/gui/gui.c
|
||
* app/widgets/gimpsessioninfo.c: changed accordingly. Do not let
|
||
gimp_dialog_factory_dialog_new() present the dialog if we need to
|
||
change it after creation. This avoids annoying resizes, noticeable
|
||
especially with the error dialog.
|
||
|
||
2004-08-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpdockable.c
|
||
* libgimp/gimpdrawablepreview.c: converted tabs to spaces.
|
||
|
||
2004-08-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpdrawablepreview.c: added a style property for the
|
||
minimum size.
|
||
|
||
* etc/gtkrc: show how to adjust the size of GimpDrawablePreviews.
|
||
|
||
2004-08-31 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpdatafactoryview.c
|
||
(gimp_data_factory_view_activate_item): emit "clicked" on the
|
||
edit_button only if it exists and is sensitive. Fixes bug #151343.
|
||
|
||
2004-08-31 Manish Singh <yosh@gimp.org>
|
||
|
||
* app/plug-in/plug-in.c (plug_in_open): cast plug_in_recv_message
|
||
to GSourceFunc.
|
||
|
||
2004-08-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreview.c: handle the widget size dynamically.
|
||
Hide scrollbars when there's nothing to scroll.
|
||
|
||
* libgimp/gimpdrawablepreview.c: simplified a lot. The scrollbars
|
||
are handled completely in the GimpPreview widget now.
|
||
|
||
2004-08-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreview.c: removed the hardcoded preview size,
|
||
removed some redundant assertions.
|
||
|
||
2004-08-31 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-scripts.[ch]: removed the GUI code...
|
||
Also did some minor cleanups.
|
||
|
||
* plug-ins/script-fu/script-fu-interface.[ch]: ...and added it here.
|
||
|
||
* plug-ins/script-fu/script-fu-types.h: new file keeping the
|
||
various struct defs needed by both the above files.
|
||
|
||
* plug-ins/script-fu/Makefile.am
|
||
* plug-ins/script-fu/siod-wrapper.c: changed accordingly.
|
||
|
||
2004-08-31 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreview.c (gimp_preview_toggle_callback):
|
||
notify the "update" property on the preview, not the toggle.
|
||
|
||
2004-08-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreview.c: allow to pan the preview with all
|
||
mouse buttons. Set a cursor to indicate that panning is possible.
|
||
|
||
2004-08-31 DindinX <david@dindinx.org>
|
||
|
||
* libgimpwidgets/gimppreview.c
|
||
* libgimpwidgets/gimppreview.h: renamed the "updated" signal to
|
||
"invalidated" and the confusing "update" virtual function to "draw".
|
||
|
||
Gave the properties saner names, too.
|
||
|
||
Removed _get_width and _get_height functions in favor of a _get_size
|
||
one.
|
||
|
||
Added gimp_preview_invalidate function that emits the "invalidated"
|
||
signal if needed.
|
||
|
||
* libgimp/gimpdrawablepreview.c
|
||
* libgimp/gimpdrawablepreview.h: modified accordingly and fixed the
|
||
scrollbar range.
|
||
|
||
* plug-ins/common/despeckle.c
|
||
* plug-ins/common/gauss.c
|
||
* plug-ins/common/neon.c
|
||
* plug-ins/common/sobel.c
|
||
* plug-ins/common/softglow.c
|
||
* plug-ins/common/spread.c
|
||
* plug-ins/common/unsharp.c: modified accordingly.
|
||
|
||
2004-08-31 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-scripts.c: removed the script title
|
||
label and moved the "About" button to the action_area. Minor
|
||
cleanups.
|
||
|
||
2004-08-31 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpdrawable-transform.[ch]: added GimpProgress
|
||
parameter to gimp_drawable_transform_affine().
|
||
|
||
* tools/pdbgen/pdb/edit.pdb
|
||
* tools/pdbgen/pdb/transform_tools.pdb: show progress for "blend"
|
||
and all transform functions.
|
||
|
||
* app/pdb/edit_cmds.c
|
||
* app/pdb/transform_tools_cmds.c: regenerated.
|
||
|
||
2004-08-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/curve_bend.c: don't use GDK_TOP_LEFT_ARROW
|
||
to restore the default cursor, simply pass NULL to
|
||
gdk_window_set_cursor().
|
||
|
||
2004-08-31 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint/gimppaintoptions.[ch]: added "GimpPaintInfo *paint_info"
|
||
member and construct property. Changed gimp_paint_options_new()
|
||
to take only a GimpPaintInfo parameter.
|
||
|
||
* app/core/gimpitem.c (gimp_item_stroke)
|
||
* app/core/gimppaintinfo.c (gimp_paint_info_new): changed accordingly.
|
||
|
||
* app/core/gimpchannel.c (gimp_channel_stroke)
|
||
* app/vectors/gimpvectors.c (gimp_vectors_stroke): use
|
||
paint_options->paint_info->paint_type directly instead of casting
|
||
to GimpToolOptions and using
|
||
tool_options->tool_info->paint_info->paint_type (eek). Fixes crash
|
||
when stroking via the PDB because newly created GimpToolOptions
|
||
instances have no "tool_info" pointer yet.
|
||
|
||
* tools/pdbgen/pdb/paint_tools.pdb: changed all paint PDB wrappers
|
||
accordingly.
|
||
|
||
* app/pdb/paint_tools_cmds.c: regenerated.
|
||
|
||
2004-08-31 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/config/gimpconfig.c (gimp_config_iface_duplicate): set
|
||
construct_param->foo, not construct_param*s*->foo, so we don't set
|
||
the first construct param again and crash.
|
||
|
||
2004-08-31 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/cubism.c: added "..." to the progress text.
|
||
|
||
2004-08-31 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/file-actions.c (file_actions): added "..." to "Revert".
|
||
|
||
2004-08-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpuitypes.h
|
||
* libgimpwidgets/gimpwidgetstypes.h: moved the GimpDrawablePreview
|
||
typedef to the header file that it belongs to.
|
||
|
||
* libgimp/gimpdrawablepreview.[ch]: minor include cleanups and
|
||
gtk-doc fixes.
|
||
|
||
2004-08-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/gauss.c (gauss_dialog): update the preview when
|
||
the blur radius is being changed. gimp_coordinates_new() seems to
|
||
be broken though; there shouldn't be two signal connections needed
|
||
here.
|
||
|
||
2004-08-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpdrawablepreview.[ch]
|
||
* libgimpwidgets/gimppreview.[ch]: minor code cleanup, fixes to
|
||
gtk-doc comments and to the handling of object properties.
|
||
|
||
2004-08-31 DindinX <david@dindinx.org>
|
||
|
||
* libgimpwidgets/gimppreview.c
|
||
* libgimpwidgets/gimppreview.h: added a GimpPreview widget, abstract
|
||
base for a GimpDrawablePreview.
|
||
|
||
* libgimpwidgets/Makefile.am
|
||
* libgimpwidgets/gimpwidgets.h
|
||
* libgimpwidgets/gimpwidgetstypes.h: modified accordingly.
|
||
|
||
* libgimp/gimpdrawablepreview.c
|
||
* libgimp/gimpdrawablepreview.h: added a GimpDrawablePreview widget
|
||
to ease the use of previews by plug-ins.
|
||
|
||
* libgimp/Makefile.am
|
||
* libgimp/gimpui.h: Changed accordingly.
|
||
|
||
* plug-ins/common/despeckle.c
|
||
* plug-ins/common/gauss.c
|
||
* plug-ins/common/neon.c
|
||
* plug-ins/common/sobel.c
|
||
* plug-ins/common/softglow.c
|
||
* plug-ins/common/spread.c
|
||
* plug-ins/common/unsharp.c: use a GimpDrawablePreview with these
|
||
plug-ins.
|
||
|
||
2004-08-30 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/plug-in/plug-in-progress.[ch]: added boolean return values
|
||
to plug_in_progress_install(), uninstall() and cancel(). Added
|
||
checks to make sure the installed progress_callback exists, has
|
||
the correct signature and was installed by this plug-in.
|
||
|
||
* tools/pdbgen/pdb/progress.pdb: use the return values to let the
|
||
PDB wrappers succeed/fail.
|
||
|
||
* app/pdb/progress_cmds.c: regenerated.
|
||
|
||
2004-08-30 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* libgimp/gimp.def: added gimp_progress_install &
|
||
gimp_progress_uninstall
|
||
|
||
2004-08-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpregioniterator.c: document the fact that "run_mode"
|
||
is unused. Also did some code cleanup.
|
||
|
||
2004-08-30 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimp/gimpregioniterator.c: always update the progress.
|
||
Makes all "run_mode" parameters useless.
|
||
|
||
2004-08-30 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/gauss.c: add "..." to the progress text.
|
||
|
||
2004-08-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpprogress.c: added some gtk-doc comments, could be
|
||
improved further.
|
||
|
||
2004-08-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/colortoalpha.c
|
||
* plug-ins/common/compose.c
|
||
* plug-ins/common/decompose.c
|
||
* plug-ins/common/film.c
|
||
* plug-ins/fits/fits.c: always use the progress API, not doing it
|
||
in non-interactive mode has always been wrong.
|
||
|
||
2004-08-30 Manish Singh <yosh@gimp.org>
|
||
|
||
* libgimp/gimpprogress.[ch] (gimp_progress_uninstall): return the
|
||
user_data pointer on uninstall. Eases language binding work.
|
||
|
||
2004-08-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpbrushmenu.c (gimp_brush_select_preview_draw): fixed
|
||
drawing of brushes that extend beyond the preview.
|
||
|
||
2004-08-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimpvectortool.[ch] (gimp_vector_tool_status_set):
|
||
avoid excessive use of strdup() and strcmp(). The strings are all
|
||
constant anyway.
|
||
|
||
2004-08-30 Michael Natterer <mitch@gimp.org>
|
||
|
||
Brought the PDB progress into a working state. Fixes bug #6010,
|
||
addresses bugs #97266 and #135185 and unfortunately reopens bug
|
||
#150194 (will fix that later).
|
||
|
||
* libgimpbase/gimpbaseenums.h: added enum GimpProgressCommand.
|
||
|
||
* app/core/gimppdbprogress.c
|
||
* libgimp/gimpprogress.c: use the enum instead of integer
|
||
constants for the different progress commands. Cleanup.
|
||
|
||
* app/plug-in/plug-in-progress.c
|
||
* app/plug-in/plug-in-run.c
|
||
* app/plug-in/plug-in.c: switch back to real refcounting for
|
||
plug_in->progress (reopens bug #150194) and enabled the PDB
|
||
progress code.
|
||
|
||
* plug-ins/script-fu/script-fu-scripts.c: cleaned up the
|
||
progress stuff and the script-fu interface a bit.
|
||
|
||
* plug-ins/pygimp/gimpenums.py
|
||
* plug-ins/script-fu/script-fu-constants.c
|
||
* tools/pdbgen/enums.pl: regenerated.
|
||
|
||
2004-08-29 Manish Singh <yosh@gimp.org>
|
||
|
||
* app/plug-in/plug-in.c (plug_in_open): set can_recurse on the
|
||
recv_message watch, so we don't block on recursive calls to the
|
||
handler. plug_in_recv_message needs some refcounting help now
|
||
though.
|
||
|
||
2004-08-29 Helvetix Victorinox <helvetix@gimp.org>
|
||
|
||
* app/composite/gimp-composite-x86.h
|
||
* app/composite/gimp-composite-sse.c
|
||
* app/composite/gimp-composite-sse2.c: Fixed a bunch of
|
||
warnings due to bad type casting.
|
||
|
||
* app/composite/gimp-composite-mmx.c
|
||
* app/composite/gimp-composite-sse.c
|
||
* app/composite/gimp-composite-x86.h
|
||
* app/composite/gimp-composite-sse2.c:
|
||
The last changes to fix the the clobber registers bug #147013.
|
||
Commented out some dead code to be reviewed later.
|
||
|
||
2004-08-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
Added an API to allow plug-ins to embed the progress for the
|
||
actions they trigger into their own GUI (attention: half-done and
|
||
broken code ahead...)
|
||
|
||
* app/core/Makefile.am
|
||
* app/core/core-types.h
|
||
* app/core/gimppdbprogress.[ch]: new object implementing dispatching
|
||
progress calls to a temporary PDB procedure in a plug-in.
|
||
|
||
* app/Makefile.am: force to link gimppdbprogress.o, bah!
|
||
|
||
* app/plug-in/plug-in-progress.[ch]: added API to install,
|
||
uninstall and cancel a PDB progress for this plug-in, but disabled
|
||
the implementation because it doesn't work yet.
|
||
|
||
* tools/pdbgen/pdb/progress.pdb: added pdb wrappers for the new
|
||
install, uninstall and cancel functions.
|
||
|
||
* libgimp/Makefile.am
|
||
* libgimp/gimp.h
|
||
* libgimp/gimpprogress.[ch]: added an API around the PDB progress
|
||
stuff.
|
||
|
||
* app/pdb/internal_procs.c
|
||
* app/pdb/progress_cmds.c
|
||
* libgimp/gimpprogress_pdb.[ch]: regenerated.
|
||
|
||
* plug-ins/script-fu/script-fu-scripts.c: use the new API to show
|
||
the progress in the script-fu dialog.
|
||
|
||
2004-08-29 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* libgimpwidgets/gimpwidgets.def: added
|
||
gimp_scale_entry_set_logarithmic
|
||
|
||
2004-08-29 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/config/gimpconfigwriter.c: don't emit critical warnings
|
||
about a messed up state of GimpConfigWriter if the writer is
|
||
disabled because of a write error that occured earlier.
|
||
|
||
2004-08-29 DindinX <david@dindinx.org>
|
||
|
||
* app/core/core-enums.h: Renamed GimpPreviewSize to GimpViewSize.
|
||
|
||
* app/core/core-enums.c: Regenerated.
|
||
|
||
* app/actions/dockable-actions.c
|
||
|
||
* app/config/gimpcoreconfig.c
|
||
* app/config/gimpcoreconfig.h
|
||
* app/config/gimpdisplayconfig.c
|
||
* app/config/gimpdisplayconfig.h
|
||
|
||
* app/core/gimpundo.c
|
||
|
||
* app/display/gimpnavigationeditor.c
|
||
|
||
* app/gui/dialogs.c
|
||
* app/gui/file-open-location-dialog.c
|
||
|
||
* app/tools/gimppaintoptions-gui.c
|
||
* app/tools/gimptextoptions.c
|
||
|
||
* app/widgets/gimpbrushselect.c
|
||
* app/widgets/gimpcontainerpopup.c
|
||
* app/widgets/gimpcontainerview.c
|
||
* app/widgets/gimpdialogfactory.c
|
||
* app/widgets/gimpfontselect.c
|
||
* app/widgets/gimpgradientselect.c
|
||
* app/widgets/gimppaletteselect.c
|
||
* app/widgets/gimppatternselect.c
|
||
* app/widgets/gimpselectioneditor.c
|
||
* app/widgets/gimpsessioninfo.c
|
||
* app/widgets/gimptemplateeditor.c
|
||
* app/widgets/gimpundoeditor.c
|
||
* app/widgets/gimpundoeditor.h
|
||
* app/widgets/gimpviewablebutton.c: Changed accordingly.
|
||
|
||
2004-08-28 Helvetix Victorinox <helvetix@gimp.org>
|
||
|
||
* app/composite/gimp-composite-sse.c
|
||
* app/composite/gimp-composite-sse2.c: More updates to accomodate
|
||
the clobber registers. Additional progress against bug #147013.
|
||
|
||
* app/composite/gimp-composite-sse.h: Fixed a bug where the wrong
|
||
manifest constant definition caused sse2 instructions to never be
|
||
compiled.
|
||
|
||
2004-08-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/vpropagate.c (run): fixed confusion about which
|
||
mode to use when being run with last values (bug #151308).
|
||
|
||
2004-08-28 Simon Budig <simon@gimp.org>
|
||
|
||
* plug-ins/common/plugindetails.c: workaround to avoid a warning
|
||
by gcc about the use of "%c" in the format string for strftime.
|
||
|
||
2004-08-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpwidgets.[ch]: applied a patch from Joao
|
||
S. O. Bueno which adds an API that allows to make the scale widget
|
||
of a GimpScaleEntry behave logarithmic. Fixes bug #149420.
|
||
|
||
* app/widgets/gimpbrusheditor.c: use the new functionality for the
|
||
radius control.
|
||
|
||
2004-08-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/compose.c (compose_dialog): applied patch from
|
||
Markus Triska that improves which layers are choosen by
|
||
default (bug #148172).
|
||
|
||
2004-08-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpimage-contiguous-region.c
|
||
(find_contiguous_region_helper): applied a patch from Eric Cheung
|
||
that changes the function to use a GQueue to implement recursion
|
||
instead of recursive function calls. Fixes bug #151124.
|
||
|
||
* plug-ins/common/noisify.c (noisify_dialog): left-align the
|
||
preview.
|
||
|
||
2004-08-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimphelp-ids.h
|
||
* app/widgets/gimptoolbox.c (toolbox_create_image_area): added a
|
||
help-id for the image area.
|
||
|
||
2004-08-27 Michael Natterer <mitch@gimp.org>
|
||
|
||
Moved the gimp_progress_init() and gimp_progress_update() PDB
|
||
functions to their own group because they don't belong to the
|
||
"Plug-In" namespace and will soon get more functions.
|
||
|
||
* tools/pdbgen/pdb/plug_in.pdb: removed the progress stuff...
|
||
|
||
* tools/pdbgen/pdb/progress.pdb: ...and added it here.
|
||
|
||
* tools/pdbgen/Makefile.am
|
||
* tools/pdbgen/groups.pl
|
||
* app/pdb/Makefile.am
|
||
* libgimp/Makefile.am: changed accordingly.
|
||
|
||
* app/pdb/progress_cmds.c
|
||
* libgimp/gimpprogress_pdb.[ch]: new generated files.
|
||
|
||
* app/pdb/internal_procs.c
|
||
* app/pdb/plug_in_cmds.c
|
||
* libgimp/gimp_pdb.h
|
||
* libgimp/gimpplugin_pdb.[ch]: regenerated.
|
||
|
||
2004-08-27 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontainereditor.c
|
||
(gimp_container_editor_construct): call
|
||
gimp_container_editor_select_item() manually at construction time
|
||
so views show the initially selected object's state correctly
|
||
(e.g. the brush spacing). Fixes bug #151227.
|
||
|
||
2004-08-27 DindinX <david@dindinx.org>
|
||
|
||
* app/widgets/gimpnavigationpreview.c
|
||
* app/widgets/gimpnavigationpreview.h: renamed these files to ...
|
||
|
||
* app/widgets/gimpnavigationview.c
|
||
* app/widgets/gimpnavigationview.h: to these.
|
||
And renamed the GimpNavigationPreview type to GimpNavigationView.
|
||
|
||
Hopefully, this is the last change in file names for the Preview->View
|
||
renaming process.
|
||
|
||
* app/display/gimpnavigationeditor.c
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h: Changed accordingly.
|
||
|
||
2004-08-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpitem.[ch]: removed "gboolean use_default_values"
|
||
from GimpItem::stroke().
|
||
|
||
* app/core/gimpchannel.c
|
||
* app/core/gimpselection.c
|
||
* app/vectors/gimpvectors.c: changed accordingly.
|
||
|
||
2004-08-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpitem.c (gimp_item_stroke): implement the whole
|
||
paint_options fiddling here instead of in each subclass and pass
|
||
either GimpStrokeOptions or GimpPaintOptions (instead of
|
||
GimpStrokeOptions or GimpPaintInfo) to GimpItem::stroke().
|
||
|
||
Also copied code (that needs to be abstracted to a utility
|
||
function) from the tool_manager which makes sure we really use the
|
||
global brush, pattern etc. if these options are checked in prefs.
|
||
Fixes bug #150716.
|
||
|
||
* app/core/gimpchannel.c (gimp_channel_stroke)
|
||
* app/vectors/gimpvectors.c (gimp_vectors_stroke): removed the
|
||
duplicated code mentioned above and simply use the paint_options
|
||
passed.
|
||
|
||
2004-08-26 DindinX <david@dindinx.org>
|
||
|
||
* app/widgets/gimpviewrenderervectors.h: GimpViewRendererVector is
|
||
really derived from GimpViewRenderer and not from
|
||
GimpViewRendererDrawable.
|
||
|
||
2004-08-26 DindinX <david@dindinx.org>
|
||
|
||
* app/widgets/gimppreviewrenderer-utils.c
|
||
* app/widgets/gimppreviewrenderer-utils.h
|
||
* app/widgets/gimppreviewrendererbrush.c
|
||
* app/widgets/gimppreviewrendererbrush.h
|
||
* app/widgets/gimppreviewrendererdrawable.c
|
||
* app/widgets/gimppreviewrendererdrawable.h
|
||
* app/widgets/gimppreviewrenderergradient.c
|
||
* app/widgets/gimppreviewrenderergradient.h
|
||
* app/widgets/gimppreviewrendererimage.c
|
||
* app/widgets/gimppreviewrendererimage.h
|
||
* app/widgets/gimppreviewrendererimagefile.c
|
||
* app/widgets/gimppreviewrendererimagefile.h
|
||
* app/widgets/gimppreviewrendererlayer.c
|
||
* app/widgets/gimppreviewrendererlayer.h
|
||
* app/widgets/gimppreviewrenderervectors.c
|
||
* app/widgets/gimppreviewrenderervectors.h: Renamed all these files...
|
||
|
||
* app/widgets/gimpviewrenderer-utils.c
|
||
* app/widgets/gimpviewrenderer-utils.h
|
||
* app/widgets/gimpviewrendererbrush.c
|
||
* app/widgets/gimpviewrendererbrush.h
|
||
* app/widgets/gimpviewrendererdrawable.c
|
||
* app/widgets/gimpviewrendererdrawable.h
|
||
* app/widgets/gimpviewrenderergradient.c
|
||
* app/widgets/gimpviewrenderergradient.h
|
||
* app/widgets/gimpviewrendererimage.c
|
||
* app/widgets/gimpviewrendererimage.h
|
||
* app/widgets/gimpviewrendererimagefile.c
|
||
* app/widgets/gimpviewrendererimagefile.h
|
||
* app/widgets/gimpviewrendererlayer.c
|
||
* app/widgets/gimpviewrendererlayer.h
|
||
* app/widgets/gimpviewrenderervectors.c
|
||
* app/widgets/gimpviewrenderervectors.h: ... to these names. And also
|
||
changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones.
|
||
|
||
* app/tools/gimppaintoptions-gui.c
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/gimpcomponenteditor.c
|
||
* app/widgets/gimpfiledialog.c
|
||
* app/widgets/gimpgradienteditor.c
|
||
* app/widgets/gimpview.c
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpviewrenderer.c
|
||
* app/widgets/gimpviewrenderer.h: modified accordingly.
|
||
|
||
2004-08-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/sanity.c (sanity_check_filename_encoding): try to convert
|
||
the result of gimp_directory() to UTF-8 and bail out with a
|
||
moderately helpful error message if this conversion fails. Works
|
||
around bug #150917. Also marked these strings for translation.
|
||
|
||
2004-08-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimp-tools.c (gimp_tools_register): set the paintbrush
|
||
as the default tool as suggested in bug #151091.
|
||
|
||
2004-08-26 DindinX <david@dindinx.org>
|
||
|
||
* app/widgets/gimppreview-popup.c
|
||
* app/widgets/gimppreview-popup.h
|
||
* app/widgets/gimppreviewrenderer.c
|
||
* app/widgets/gimppreviewrenderer.h: really removed these files from
|
||
cvs.
|
||
|
||
2004-08-25 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/common/gifload.c: Guard against bogus logical screen
|
||
dimensions. Fixes bug #151053.
|
||
|
||
2004-08-26 DindinX <david@dindinx.org>
|
||
|
||
* app/widgets/gimppreview-popup.c
|
||
* app/widgets/gimppreview-popup.h: renamed these files...
|
||
|
||
* app/widgets/gimpview-popup.c
|
||
* app/widgets/gimpview-popup.h: .. to these files, and changed the
|
||
GimpPreviewPopup type to GimpViewPopup.
|
||
|
||
* app/widgets/gimppreviewrenderer.c
|
||
* app/widgets/gimppreviewrenderer.h: renamed these files...
|
||
|
||
* app/widgets/gimpviewrenderer.c
|
||
* app/widgets/gimpviewrenderer.h: .. to these files, and changed
|
||
GimpPreviewRenderer to GimpViewRenderer.
|
||
|
||
This is the second step of the great Preview->View renaming process.
|
||
|
||
* app/display/gimpdisplayshell-layer-select.c
|
||
* app/display/gimpnavigationeditor.c
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/gimpbrushfactoryview.c
|
||
* app/widgets/gimpbufferview.c
|
||
* app/widgets/gimpcellrendererviewable.c
|
||
* app/widgets/gimpcellrendererviewable.h
|
||
* app/widgets/gimpcomponenteditor.c
|
||
* app/widgets/gimpcontainerbox.c
|
||
* app/widgets/gimpcontainercombobox.c
|
||
* app/widgets/gimpcontainereditor.c
|
||
* app/widgets/gimpcontainerentry.c
|
||
* app/widgets/gimpcontainergridview.c
|
||
* app/widgets/gimpcontainerpopup.c
|
||
* app/widgets/gimpcontainertreeview-dnd.c
|
||
* app/widgets/gimpcontainertreeview.c
|
||
* app/widgets/gimpcontainerview.c
|
||
* app/widgets/gimpdatafactoryview.c
|
||
* app/widgets/gimpitemtreeview.c
|
||
* app/widgets/gimplayertreeview.c
|
||
* app/widgets/gimpnavigationpreview.c
|
||
* app/widgets/gimppatternfactoryview.c
|
||
* app/widgets/gimppreviewrenderer-utils.c
|
||
* app/widgets/gimppreviewrendererbrush.c
|
||
* app/widgets/gimppreviewrendererbrush.h
|
||
* app/widgets/gimppreviewrendererdrawable.c
|
||
* app/widgets/gimppreviewrendererdrawable.h
|
||
* app/widgets/gimppreviewrenderergradient.c
|
||
* app/widgets/gimppreviewrenderergradient.h
|
||
* app/widgets/gimppreviewrendererimage.c
|
||
* app/widgets/gimppreviewrendererimage.h
|
||
* app/widgets/gimppreviewrendererimagefile.c
|
||
* app/widgets/gimppreviewrendererimagefile.h
|
||
* app/widgets/gimppreviewrendererlayer.c
|
||
* app/widgets/gimppreviewrenderervectors.c
|
||
* app/widgets/gimpselectioneditor.c
|
||
* app/widgets/gimptemplateview.c
|
||
* app/widgets/gimptooloptionseditor.c
|
||
* app/widgets/gimptoolview.c
|
||
* app/widgets/gimpview.c
|
||
* app/widgets/gimpview.h
|
||
* app/widgets/gimpviewablebutton.c
|
||
* app/widgets/widgets-enums.h
|
||
* app/widgets/widgets-types.h: Modified accordingly.
|
||
|
||
2004-08-25 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimperrordialog.[ch] (gimp_error_dialog_add): stop
|
||
adding message boxes and redirect messages to stderr if there are
|
||
too many messages.
|
||
|
||
2004-08-25 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* devel-docs/ggr.txt: fix incorrect statement, add note re SVG.
|
||
|
||
2004-08-25 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat().
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimperrordialog.[ch]: added new dialog that adds a new
|
||
GimpMessageBox for each message added. Fixes bug #92604.
|
||
|
||
* app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box()
|
||
functionality.
|
||
|
||
* app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog.
|
||
|
||
* app/gui/dialogs-constructors.[ch]
|
||
* app/gui/dialogs.c: manage GimpErrorDialog as singleton.
|
||
|
||
* app/gui/gui-vtable.c (gui_message): use the new error dialog.
|
||
|
||
* app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL
|
||
domain.
|
||
|
||
* app/widgets/gimperrorconsole.c (gimp_error_console_add): fail
|
||
when being called with a NULL domain.
|
||
|
||
2004-08-25 DindinX <david@dindinx.org>
|
||
|
||
* app/display/gimpnavigationeditor.[ch]: eradicate some more previews
|
||
in favor of views.
|
||
|
||
2004-08-25 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* devel-docs/Makefile.am
|
||
* devel-docs/ggr.txt: added new file decribing the ggr (Gimp
|
||
gradient) file format.
|
||
|
||
2004-08-25 DindinX <david@dindinx.org>
|
||
|
||
* app/display/gimpnavigationview.c
|
||
* app/display/gimpnavigationview.h: renamed these files to...
|
||
|
||
* app/display/gimpnavigationeditor.c
|
||
* app/display/gimpnavigationeditor.h: ... these files, and of course
|
||
changed GimpNavigationView to GimpNavigationEditor since it is really
|
||
inherited from GimpEditor anyway.
|
||
|
||
This will leave the gimp_navigation_view namespace for the renaming
|
||
from gimp_navigation_preview.
|
||
|
||
* app/display/Makefile.am
|
||
* app/display/display-types.h
|
||
* app/display/gimpdisplayshell-callbacks.c
|
||
* app/gui/dialogs-constructors.c: Changed accordlingly.
|
||
|
||
2004-08-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-title.c
|
||
(gimp_display_shell_format_title): print bad '%' sequences
|
||
literally instead of warning (g_warning() is for programming
|
||
errors only and must never be triggered by bad or intermediate
|
||
user input). Fixes bug #150676
|
||
|
||
2004-08-24 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpmessagebox.c: put the icon to the right for RTL
|
||
layouts.
|
||
|
||
* app/display/gimpdisplayshell-close.c
|
||
* app/gui/quit-dialog.c: use a GimpMessageBox.
|
||
|
||
2004-08-24 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpmessagebox.[ch]: added API to change the labels.
|
||
Modeled after the proposed new API for GtkMessageDialog.
|
||
|
||
* app/widgets/gimpwidgets-utils.c: changed accordingly.
|
||
|
||
2004-08-24 DindinX <david@dindinx.org>
|
||
|
||
* app/widgets/gimppreview.c
|
||
* app/widgets/gimppreview.h: renamed these two files to...
|
||
|
||
* app/widgets/gimpview.c
|
||
* app/widgets/gimpview.h: ... these files.
|
||
|
||
Also renamed GimpPreview to GimpView.
|
||
This is the first step of the great Preview->View renaming process.
|
||
|
||
* app/actions/palettes-commands.c
|
||
|
||
* app/display/gimpdisplayshell-layer-select.c
|
||
* app/display/gimpnavigationview.c
|
||
|
||
* app/gui/palette-import-dialog.c
|
||
|
||
* app/tools/gimppaintoptions-gui.c
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/gimpaction.c
|
||
* app/widgets/gimpactiongroup.c
|
||
* app/widgets/gimpbrusheditor.c
|
||
* app/widgets/gimpbufferview.c
|
||
* app/widgets/gimpcontainerbox.c
|
||
* app/widgets/gimpcontainergridview.c
|
||
* app/widgets/gimpcontainergridview.h
|
||
* app/widgets/gimpdevicestatus.c
|
||
* app/widgets/gimpdnd.c
|
||
* app/widgets/gimpdockbook.c
|
||
* app/widgets/gimpfiledialog.c
|
||
* app/widgets/gimpgradienteditor.c
|
||
* app/widgets/gimpnavigationpreview.c
|
||
* app/widgets/gimpnavigationpreview.h
|
||
* app/widgets/gimppaletteeditor.c
|
||
* app/widgets/gimppreview-popup.c
|
||
* app/widgets/gimppropwidgets.c
|
||
* app/widgets/gimpselectioneditor.c
|
||
* app/widgets/gimpthumbbox.c
|
||
* app/widgets/gimptoolbox-image-area.c
|
||
* app/widgets/gimptoolbox-indicator-area.c
|
||
* app/widgets/gimptooloptionseditor.c
|
||
* app/widgets/gimpviewabledialog.c
|
||
* app/widgets/widgets-types.h: changed accordingly.
|
||
|
||
2004-08-24 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpmessagebox.[ch]: added new widget GimpMessageBox.
|
||
|
||
* app/widgets/gimpwidgets-utils.c: use it for message dialogs.
|
||
|
||
2004-08-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
|
||
the filename if gtk_file_chooser_set_uri() failed.
|
||
|
||
* app/actions/file-commands.c
|
||
* app/gui/file-save-dialog.c: trivial cleanups.
|
||
|
||
* app/widgets/gimpwidgets-utils.c: removed an unused extern
|
||
variable declaration.
|
||
|
||
2004-08-23 DindinX <david@dindinx.org>
|
||
|
||
* app/tools/tools-utils.c: fixed a typo that broke the build.
|
||
|
||
2004-08-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/Makefile.am
|
||
* app/tools/tools-utils.[ch]: added gimp_tool_motion_constrain(),
|
||
|
||
* app/paint/gimppaintcore.[ch]: removed gimp_paint_core_constrain().
|
||
|
||
* app/tools/gimppainttool.c: changed accordingly.
|
||
|
||
* app/tools/gimpblendtool.[ch]: use gimp_tool_motion_constrain()
|
||
instead of duplicating that functionality.
|
||
|
||
* app/tools/gimpmeasuretool.c: use gimp_tool_motion_constrain()
|
||
instead of implementing completely different constraints.
|
||
|
||
2004-08-22 Simon Budig <simon@gimp.org>
|
||
|
||
* app/vectors/gimpbezierstroke.c: Implemented the ellipse basic
|
||
shape differently to avoid possible rounding issues with
|
||
the _arcto () command.
|
||
|
||
* app/vectors/gimpvectors-import.c: properly close the rounded
|
||
rectangles.
|
||
|
||
2004-08-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/vectors/gimpvectors-import.c (parse_svg_transform): support
|
||
optional center coordinates for the "rotate" transformations.
|
||
(parse_svg_transform): apply transformations in reverse order. The
|
||
SVG spec is rather confusing here.
|
||
|
||
2004-08-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/vectors/gimpbezierstroke.c (gimp_bezier_stroke_arcto): fixed
|
||
a bug I introduced with my last commit.
|
||
|
||
* app/vectors/gimpvectors-import.c: added support for the basic
|
||
SVG shape "rect". Fixed handling of SVG lengths in basic shapes.
|
||
|
||
2004-08-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/vectors/gimpbezierstroke.[ch]: added new function
|
||
gimp_bezier_stroke_new_ellipse() that provides a simple API to
|
||
create a bezier stroke that represents an ellipse.
|
||
|
||
* app/vectors/gimpvectors-import.c: added support for the basic
|
||
SVG shapes "circle" and "ellipse".
|
||
|
||
2004-08-21 Simon Budig <simon@gimp.org>
|
||
|
||
* plug-ins/common/gih.c: Fix some GUI issues. Make the relation
|
||
between the dimension parameter and the rank thingies more clear
|
||
also changed to a nicer layout.
|
||
|
||
2004-08-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/vectors/gimpvectors-import.c: added support for the basic
|
||
SVG shapes "polyline" and "polygon".
|
||
|
||
2004-08-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/vectors/gimpvectors-import.c: added support for importing
|
||
the basic SVG shape "line". Other shapes will follow...
|
||
|
||
2004-08-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/layers-actions.[ch]
|
||
* app/actions/layers-commands.[ch]
|
||
* app/widgets/gimplayertreeview.c: added actions to handle layer
|
||
masks as suggested in bug #150446.
|
||
|
||
* menus/layers-menu.xml: added menu entries for new actions,
|
||
commented out raise/lower menu entries.
|
||
|
||
2004-08-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* modules/controller_linux_input.c: declare local function as static.
|
||
|
||
2004-08-19 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* plug-ins/common/guillotine.c: modified the coordinate insertion
|
||
into the file name to leave the file extension intact, changed the
|
||
format of the coordinates. Fixes bug #101901.
|
||
|
||
2004-08-18 Manish Singh <yosh@gimp.org>
|
||
|
||
* app/widgets/gimpcellrendereraccel.c
|
||
* app/widgets/gimphistogrambox.c
|
||
* plug-ins/gfig/gfig-dialog.c: Get rid of some unnecessary casts.
|
||
|
||
2004-08-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/color-notebook.c: no need to set a size_request here.
|
||
|
||
* libgimpwidgets/gimpcolorselection.c: HIG-ified spacings.
|
||
|
||
* libgimpwidgets/gimpcolorscales.c
|
||
* modules/colorsel_cmyk.c: don't set a minimum width on the color
|
||
scales. Improves behaviour for narrow color dockables.
|
||
|
||
2004-08-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* modules/colorsel_triangle.c: fixed crashes that occured with
|
||
small sizes, some code cleanups and a simple optimization.
|
||
|
||
2004-08-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimphelp-ids.h: define GIMP_HELP_DOCK_SEPARATOR.
|
||
|
||
* app/widgets/gimpdock.c
|
||
* app/widgets/gimpdockable.c: help-ids are never used directly,
|
||
use the defines from app/widgets/gimphelp-ids.h instead.
|
||
|
||
2004-08-17 Simon Budig <simon@gimp.org>
|
||
|
||
* modules/colorsel_triangle.c: Made the triangle colorselector
|
||
resizeable. Removed minimum size request (would probably need some
|
||
testing for *very* small sizes though).
|
||
|
||
2004-08-17 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/widgets/gimpdock.c
|
||
* app/widgets/gimpdockable.c: add help-ids.
|
||
|
||
2004-08-17 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/plug-in/plug-in-progress.c (plug_in_progress_start): reset
|
||
the "cancel" signal handler id when a new progress is set.
|
||
|
||
2004-08-17 Sven Neumann <sven@gimp.org>
|
||
|
||
* modules/colorsel_cmyk.c: minor cleanups.
|
||
|
||
* modules/colorsel_water.c: let the widget take the available
|
||
space, don't set a minimum size.
|
||
|
||
2004-08-17 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/plug-in/plug-in-progress.c
|
||
* app/plug-in/plug-in-run.c
|
||
* app/plug-in/plug-in.c: don't keep a strong reference to the
|
||
GimpProgress object, instead use a weak reference and deal with
|
||
the progress being destroyed while the plug-in is running.
|
||
Fixes bug #150194.
|
||
|
||
2004-08-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpcolorframe.c (gimp_color_frame_update): fixed
|
||
labels in CMYK mode. Fixes bug #150213.
|
||
|
||
2004-08-16 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/iwarp.c: fixed a typo preventing the preview to be
|
||
redrawn correctly in some case. Reported by AndyFitz.
|
||
|
||
2004-08-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* modules/colorsel_triangle.c: minor cleanups.
|
||
|
||
* modules/colorsel_water.c: GimpPreviewArea seems like overkill
|
||
here, use a GtkDrawingArea instead.
|
||
|
||
2004-08-15 DindinX <david@dindinx.org>
|
||
|
||
* modules/colorsel_triangle.c
|
||
* modules/colorsel_water.c: Replaced the GtkPreviews by
|
||
GimpPreviewAreas.
|
||
|
||
2004-08-14 Manish Singh <yosh@gimp.org>
|
||
|
||
* libgimpbase/gimpprotocol.c (_gp_params_read): make sure array
|
||
length values are not negative, to prevent bad calls to g_new.
|
||
Addresses bug #150154.
|
||
|
||
2004-08-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/help/Makefile.am: no need to link gimp-help-lookup with
|
||
any GIMP libraries.
|
||
|
||
* plug-ins/help/domain.[ch]: allow to specify the location of the
|
||
index files independently from the base URL.
|
||
|
||
* plug-ins/help/help.c: changed accordingly.
|
||
|
||
* plug-ins/help/gimp-help-lookup.c: added command-line options to
|
||
specify base URI and root directory for index files.
|
||
|
||
2004-08-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/help/locales.c (locales_parse): don't mess up the order
|
||
of languages.
|
||
|
||
* plug-ins/help/gimp-help-lookup.c: parse command-line options,
|
||
added --help output.
|
||
|
||
2004-08-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/help/help.[ch]: moved some defines to the header file.
|
||
|
||
* plug-ins/help/domain.c: trivial change to remove the libgimpbase
|
||
dependency.
|
||
|
||
* plug-ins/help/Makefile.am
|
||
* plug-ins/help/gimp-help-lookup.c: added a very simple
|
||
command-line tool that allows to lookup a help-id.
|
||
|
||
2004-08-13 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/edge.c: update the preview when the user choose a
|
||
different algorithm from the combo box. This was one of the main
|
||
reasons to have a preview here, after all.
|
||
|
||
2004-08-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/edge.c (edge_dialog): use a combo box instead of
|
||
too many radio buttons.
|
||
|
||
2004-08-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpmenufactory.c (gimp_menu_factory_manager_new):
|
||
make sure that all actions, even if they have no menu proxy, can
|
||
be invoked by their accelerators. Fixes bug #149938.
|
||
|
||
* app/widgets/gimpimagedock.c (gimp_image_dock_constructor):
|
||
removed the same code here.
|
||
|
||
* app/widgets/gimpactionview.[ch] (gimp_action_view_dispose): new
|
||
function which disconnects from "accel_changed" of the accel_group
|
||
before upchaining (== before emitting "destroy").
|
||
|
||
The above changes make this one redundant, but since the crash in
|
||
bug #149938 was triggered by "accel_changed" emitted in the middle
|
||
of g_object_unref(tree_model), it feels better to be paranoic here
|
||
(fiddling with objects in destruction is no fun).
|
||
|
||
(gimp_action_view_accel_edited): don't warn if assigning the same
|
||
accel to the same action again.
|
||
|
||
(gimp_action_view_new): don't leak all accel_closures.
|
||
|
||
2004-08-12 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/edge.c: added a preview.
|
||
|
||
2004-08-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/sel_gauss.c
|
||
* plug-ins/common/unsharp.c: place the preview widget into the
|
||
upper left corner like all other plug-ins do.
|
||
|
||
* plug-ins/help/domain.c: added some (disabled) debug output.
|
||
|
||
2004-08-12 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/sel_gauss.c: added a preview.
|
||
|
||
* plug-ins/common/unsharp.c: removed unused variables.
|
||
|
||
2004-08-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/context-actions.c: changed the icons to indicate
|
||
what part of the context is affected by the action. Looks better
|
||
in the shortcut editor.
|
||
|
||
2004-08-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/cartoon.c
|
||
* plug-ins/common/neon.c
|
||
* plug-ins/common/photocopy.c
|
||
* plug-ins/common/softglow.c: added four new plug-ins contributed
|
||
by Spencer Kimball. Ported them from 1.2 to 2.1 APIs.
|
||
|
||
* plug-ins/common/plugin-defs.pl: added them here.
|
||
|
||
* plug-ins/common/mkgen.pl: removed tab insanity now that
|
||
libgimpoldpreview is gone.
|
||
|
||
* plug-ins/common/.cvsignore
|
||
* plug-ins/common/Makefile.am: regenerated.
|
||
|
||
2004-08-11 DindinX <david@dindinx.org>
|
||
|
||
Bad DindinX! Don't break the build!
|
||
|
||
* configure.in
|
||
* plug-ins/common/mkgen.pl
|
||
* plug-ins/common/plugin-defs.pl: removed libgimpoldpreview from
|
||
here too.
|
||
|
||
* plug-ins/common/Makefile.am: regenerated.
|
||
|
||
2004-08-11 DindinX <david@dindinx.org>
|
||
|
||
Removed the GimpOldPreview stuff. Die, crap, die!
|
||
|
||
* plug-ins/libgimpoldpreview/*: removed.
|
||
|
||
* plug-ins/Makefile.am
|
||
* plug-ins/common/Makefile.am: changed accordingly.
|
||
|
||
* plug-ins/common/max_rgb.c
|
||
* plug-ins/common/noisify.c
|
||
* plug-ins/common/tileit.c: removed last forgotten
|
||
#include "libgimpoldpreview.h".
|
||
|
||
2004-08-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontainercombobox.[ch]
|
||
* app/widgets/gimpcontainertreeview.c: when removing the last item
|
||
from the view, manually clear all GimpCellRendererViewables'
|
||
"renderer" properties; otherwise we have stale GimpPreviewRenderers
|
||
with still-refed viewables hanging around in the cells.
|
||
Works around GTK+ bug #149906.
|
||
|
||
2004-08-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimp.c
|
||
* app/core/gimpimagefile.c: converted tabs to spaces, cosmetic
|
||
changes.
|
||
|
||
2004-08-11 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/waves.c: GimpPreviewArea-ified.
|
||
|
||
2004-08-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
Restored sane sorting order for menus which are created
|
||
entirely by plug-ins (like Xtns/Script-Fu/...).
|
||
|
||
* app/menus/plug-in-menus.c (plug_in_menus_build_path): made it
|
||
return the built path. For each sub-menu created, add a "Menus"
|
||
placeholder and a separator. Make sure all sub-menus end up in the
|
||
"Menus" placeholder. More readable because we can use the path
|
||
returned by the recursive invocation now.
|
||
|
||
(plug_in_menus_add_proc): simplified by using the path
|
||
plug_in_menus_build_path() returns.
|
||
|
||
2004-08-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpprogress.[ch]: added virtual function
|
||
gboolean GimpProgressInterface::is_active().
|
||
|
||
* app/display/gimpdisplay.c
|
||
* app/display/gimpstatusbar.c
|
||
* app/widgets/gimpfiledialog.c
|
||
* app/widgets/gimpprogressbox.c
|
||
* app/widgets/gimpprogressdialog.c
|
||
* app/widgets/gimpthumbbox.c: implement it.
|
||
|
||
* app/plug-in/plug-in.h: removed "gboolean progress_active" and
|
||
added "gulong progress_cancel_id" instead.
|
||
|
||
* app/plug-in/plug-in-progress.c: changed accordingly. Make sure
|
||
we correctly handle the "cancel" connections of progress instances
|
||
passed from other plug-ins.
|
||
|
||
2004-08-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/plug-in/plug-in-message.c
|
||
* app/plug-in/plug-in-run.c (plug_in_temp_run)
|
||
* libgimp/gimp.c (gimp_temp_proc_run): removed ENABLE_TEMP_RETURN
|
||
#define and all code which was in #ifndef ENABLE_TEMP_RETURN.
|
||
|
||
2004-08-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimp-gui.[ch]: added "display_ID" to gimp_new_progress().
|
||
|
||
* app/gui/gui-vtable.c: changed accordingly.
|
||
|
||
* app/plug-in/plug-in-progress.[ch]: reenabled showing the
|
||
progress in a particular display.
|
||
|
||
2004-08-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* etc/controllerrc: added a commented-out midi controller entry
|
||
with some example mappings.
|
||
|
||
2004-08-11 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/plasma.c: converted to GimpPreviewArea.
|
||
|
||
2004-08-11 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/noisify.c: converted to GimpPreviewArea. Also added
|
||
scrollbars to move around. The preview was rather useless without
|
||
them.
|
||
|
||
2004-08-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpdrawable-blend.c
|
||
* app/core/gimpprogress.c: some progress cleanup.
|
||
|
||
* app/display/gimpstatusbar.c (gimp_statusbar_progress_start): no
|
||
need to warn if there is already a progress active, just silently
|
||
return NULL as all other GimpProgressInterface implementors.
|
||
|
||
* app/plug-in/plug-in-progress.c: several progress fixes.
|
||
It's still a mess.
|
||
|
||
* plug-ins/common/url.c: don't show progress depending on
|
||
run_mode. Run the actual file plug-in with the same run_mode we
|
||
were invoked with.
|
||
|
||
2004-08-11 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/file-open-location-dialog.c
|
||
* app/widgets/gimpprogressbox.c: increased horizontal size request
|
||
to reduce resizing.
|
||
|
||
2004-08-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnails):
|
||
fixed annoying resizing when thumbnailing exactly one image.
|
||
|
||
2004-08-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpprogressbox.[ch]: new GtkVBox subclass featuring
|
||
a label and a progressbar. Implements GimpProgressIterface.
|
||
|
||
* app/widgets/gimpprogressdialog.[ch]: replaced label and progress
|
||
by a GimpProgressBox. Delegate most progress functionality to it.
|
||
|
||
* app/widgets/gimpwidgets-utils.[ch]: factored out utility
|
||
function gimp_dialog_set_sensitive().
|
||
|
||
* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_sensitive):
|
||
use it.
|
||
|
||
* app/gui/file-open-location-dialog.c (file_open_location_response):
|
||
embed the called file procedure's progress using a GimpProgressBox.
|
||
|
||
2004-08-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpfiledialog.[ch]
|
||
(gimp_file_dialog_set_sensitive): new function which works on all
|
||
widgets in the dialog except the cancel button.
|
||
|
||
Remember if the active progress is cancelable and added two
|
||
booleans "busy" and "canceled". Added GtkDialog::response()
|
||
implementation which, if the dialog is busy, cancels the active
|
||
progress and sets the dialog's "canceled" state.
|
||
|
||
Moved the progress bar right above the action area so it is next
|
||
to the cancel button and in the same place for both open and save
|
||
dialogs.
|
||
|
||
* app/gui/file-open-dialog.c
|
||
* app/gui/file-save-dialog.c: use the new API to make image loading
|
||
and saving cancelable again.
|
||
|
||
* app/widgets/gimpthumbbox.c: use the same stuff to make
|
||
thumbnailing cancelable. Increased the minimum height a bit so it
|
||
doesn't resize when the progress bars are shown.
|
||
|
||
2004-08-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
Redid the whole internal progress stuff: don't pass around
|
||
progress_callback and progress_data; instead, provide a
|
||
pointer to a GimpProgressInterface which can be implemented
|
||
by a variety of backends.
|
||
|
||
Addresses (but not yet fixes) bugs #6010, #97266 and #135185.
|
||
|
||
* app/display/Makefile.am
|
||
* app/display/gimpprogress.[ch]: removed the old progress hack.
|
||
|
||
* app/core/Makefile.am
|
||
* app/core/core-types.h
|
||
* app/core/gimpprogress.[ch]: implement GimpProgressInterface.
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpprogressdialog.[ch]: the standalone progress
|
||
dialog as widget implementing GimpProgressInterface.
|
||
|
||
* app/display/gimpdisplay.c
|
||
* app/display/gimpstatusbar.[ch]
|
||
* app/widgets/gimpfiledialog.[ch]
|
||
* app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface
|
||
implementation to these classes.
|
||
|
||
* app/core/gimp-gui.[ch]
|
||
* app/gui/gui-vtable.c: replaced the old progress vtable entries
|
||
by two new to create and destroy a GimpProgressDialog in case
|
||
no other progress is available.
|
||
|
||
* app/pdb/procedural_db.[ch]
|
||
* app/plug-in/plug-in-run.[ch]
|
||
* tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and
|
||
all plug-ins.
|
||
|
||
* app/plug-in/plug-in.[ch]
|
||
* app/plug-in/plug-ins.c
|
||
* app/plug-in/plug-in-message.c
|
||
* app/plug-in/plug-in-progress.c: handle the case there the
|
||
plug-in was crated with a progress as well as the case where it
|
||
wasn't.
|
||
|
||
* app/app_procs.c
|
||
* app/batch.c
|
||
* app/xcf/xcf.c
|
||
* app/file/file-open.[ch]
|
||
* app/file/file-save.[ch]
|
||
* app/widgets/gimphelp.c
|
||
* app/widgets/gimpbrushselect.c
|
||
* app/widgets/gimpfontselect.c
|
||
* app/widgets/gimpgradientselect.c
|
||
* app/widgets/gimppaletteselect.c
|
||
* app/widgets/gimppatternselect.c: changed accordingly.
|
||
|
||
* app/core/gimpimagefile.[ch]
|
||
* app/display/gimpdisplayshell-dnd.c
|
||
* app/gui/file-open-dialog.c
|
||
* app/gui/file-open-location-dialog.c
|
||
* app/gui/file-save-dialog.c
|
||
* app/widgets/gimplayertreeview.c
|
||
* app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file
|
||
related functions. Embed the progress in the file dialog where
|
||
possible.
|
||
|
||
* app/core/gimpdrawable-blend.[ch]
|
||
* app/core/gimpdrawable-transform.[ch]
|
||
* app/core/gimpimage-convert.[ch]
|
||
* app/core/gimpimage-flip.[ch]
|
||
* app/core/gimpimage-resize.[ch]
|
||
* app/core/gimpimage-rotate.[ch]
|
||
* app/core/gimpimage-scale.[ch]
|
||
* app/core/gimpitem-linked.[ch]
|
||
* app/core/gimpitem.[ch]
|
||
* app/core/gimpchannel.c
|
||
* app/core/gimpdrawable.c
|
||
* app/core/gimplayer.c
|
||
* app/core/gimpselection.c
|
||
* app/vectors/gimpvectors.c: replaced callback/data by GimpProgress.
|
||
|
||
* app/tools/gimpblendtool.c
|
||
* app/tools/gimptransformtool.c
|
||
* app/gui/convert-dialog.c
|
||
* app/actions/documents-commands.c
|
||
* app/actions/file-commands.c
|
||
* app/actions/image-commands.c
|
||
* app/actions/layers-commands.c
|
||
* app/actions/plug-in-commands.c
|
||
* app/actions/vectors-commands.c
|
||
* tools/pdbgen/pdb/convert.pdb
|
||
* tools/pdbgen/pdb/edit.pdb
|
||
* tools/pdbgen/pdb/image.pdb
|
||
* tools/pdbgen/pdb/layer.pdb: changed callers accordingly.
|
||
|
||
* app/pdb/*_cmds.c: regenerated.
|
||
|
||
2004-08-10 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/blinds.c: GimpPreviewArea-ified.
|
||
|
||
2004-08-10 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/AlienMap2.c: Ported to GimpPreviewArea, use an enum
|
||
for the color model instead of some defines and use gboolean instead
|
||
of gint where appropriate.
|
||
|
||
2004-08-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpbrushgenerated.c (gimp_brush_generated_load):
|
||
plugged more file descriptor leaks.
|
||
|
||
2004-08-10 DindinX <david@dindinx.org>
|
||
|
||
* app/core/gimpbrushgenerated.c: don't leak a file descriptor when
|
||
reading a bad .vbr file.
|
||
|
||
2004-08-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/unsharp.c: don't show progress on the image
|
||
window while updating the preview.
|
||
|
||
2004-08-09 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/unsharp.c (unsharp_region): reset the progress
|
||
when done; some code cleanup.
|
||
|
||
2004-08-09 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/unsharp.c: continuously show the (original) image
|
||
during a scrollbar movement. This makes it easier to navigate.
|
||
|
||
2004-08-09 Michael Natterer <mitch@gimp.org>
|
||
|
||
Applied (slightly modified) patch from Shlomi Fish which adds a
|
||
progress bar to the RGB -> INDEXED conversion. Fixes bug #145274
|
||
and shows that we really really need a GimpProgressInterface in
|
||
the core to give progress users full access to the progress API.
|
||
|
||
* app/core/gimpimage-convert.[ch]: added special
|
||
GimpImageConvertProgress function typedef to cope with the
|
||
different stages of converting. Support passing such a callback &
|
||
data to gimp_image_convert() and update the progress accordingly.
|
||
|
||
* app/gui/convert-dialog.[ch]: added a convert progress callback
|
||
and pass it to gimp_image_convert().
|
||
|
||
* app/actions/image-commands.c
|
||
* tools/pdbgen/pdb/convert.pdb: changed accordingly.
|
||
|
||
* app/pdb/convert_cmds.c: regenerated.
|
||
|
||
2004-08-09 Sven Neumann <sven@gimp.org>
|
||
|
||
* data/misc/gimp.desktop.in.in: added GenericName and Version,
|
||
updated Categories.
|
||
|
||
2004-08-09 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/plug-in/plug-ins.c
|
||
(plug_ins_file_register_magic)
|
||
(plug_ins_file_register_mime): don't dereference
|
||
gimp->current_plug_in->plug_in_def if it's NULL.
|
||
Fixes bug #149678.
|
||
|
||
(plug_ins_file_register_mime): moved returning the proc_def inside
|
||
the right if() statement.
|
||
|
||
2004-08-09 Hans Breuer <hans@breuer.org>
|
||
|
||
* app/core/gimp-edit.c (gimp_edit_paste_as_new):
|
||
gimp_create_display() with the right parameters order
|
||
|
||
* app/widgets/gimpwidgets-utils.c (gimp_message_box_set_icons)
|
||
handle gtk_style_lookup_icon_set() returnig NULL
|
||
|
||
* app/gimpcore.def app/widgets/makefile.msc
|
||
themes/default/images/makefile.msc : updated
|
||
|
||
2004-08-09 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/postscript.c (save_ps_header): use the basename
|
||
as Title, not the full filename. Fixes bug #149669.
|
||
|
||
2004-08-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/siod/sliba.c (array_prin1): when printing a
|
||
character array, don't flush the buffer for each byte but wait
|
||
until it is filled.
|
||
|
||
2004-08-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/siod-wrapper.[ch] (siod_output_string): use
|
||
g_strdup_vprintf() instead of guessing the string length. Also
|
||
declare the function using G_GNUC_PRINTF().
|
||
|
||
2004-08-08 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/ifscompose/README.ifscompose: fix out of date info,
|
||
pointed out by the author.
|
||
|
||
2004-08-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/Makefile.am: do not build test-preview-area by
|
||
default, put it into EXTRA_PROGRAMS. Fixes parallel builds.
|
||
|
||
2004-08-08 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/plug-in/plug-in-proc.[ch] (plug_in_proc_def_get_sensitive):
|
||
new function which checks a GimpImageType against the
|
||
proc_def->image_types_val mask.
|
||
|
||
* app/actions/plug-in-actions.c: use the new function here. Also
|
||
separated setting the "Repeat last" and "Reshow last" actions'
|
||
labels from setting their sensitivity and made them use the same
|
||
sensitivity logic as all other plug-in actions. Fixes bug #149567.
|
||
|
||
2004-08-07 Simon Budig <simon@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcolorscales.c: emit the COLOR_CHANGED signal
|
||
when the hex entry is changed.
|
||
|
||
2004-08-07 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/sanity.c: abort if the configured filename encoding can't be
|
||
converted to UTF-8. Fixes bug #149464 for the HEAD branch.
|
||
|
||
2004-08-07 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpgradientmenu.c (gimp_gradient_select_preview_expose):
|
||
corrected dither offset.
|
||
|
||
2004-08-07 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/max_rgb.c: use a GimpPreviewArea instead of
|
||
GimpOldPreview.
|
||
|
||
2004-08-07 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpgradientmenu.c: use a GtkDrawingArea instead of
|
||
GtkPreview.
|
||
|
||
* libgimp/gimpbrushmenu.c
|
||
* libgimp/gimppatternmenu.c: minor cleanup.
|
||
|
||
2004-08-07 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/jigsaw.c: ported to GimpPreviewArea, did some
|
||
cleanup and removed tabs.
|
||
|
||
2004-08-07 Sven Neumann <sven@gimp.org>
|
||
|
||
* configure.in: bumped version number to 2.1.4.
|
||
|
||
2004-08-07 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/illusion.c: ported to GimpPreviewArea.
|
||
|
||
2004-08-07 DindinX <david@dindinx.org>
|
||
|
||
* libgimpwidgets/gimppreviewarea.c: fixed the rendering for INDEXED
|
||
and INDEXEDA image types.
|
||
|
||
* plug-ins/common/grid.c: ported to GimpPreviewArea.
|
||
|
||
2004-08-06 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/glasstile.c: ported to GimpPreviewArea.
|
||
|
||
2004-08-06 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/nlfilt.c: ported to GimpPreviewArea.
|
||
|
||
2004-08-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimptransformtool.h: removed the recently added
|
||
"gdouble aspect_ratio"...
|
||
|
||
* app/tools/gimpscaletool.[ch]: ...and added it where it belongs.
|
||
|
||
2004-08-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
Transform tool cleanup:
|
||
|
||
* app/tools/gimptransformtool.[ch]: added new virtual function
|
||
GimpTransformTool::dialog_update().
|
||
Made wrapper for ::recalc() public and function
|
||
transform_bounding_box() private.
|
||
Call ::dialog_update() and transform_bounding_box() from the
|
||
::recalc() wrapper.
|
||
|
||
* app/tools/gimpperspectivetool.[ch]
|
||
* app/tools/gimprotatetool.[ch]
|
||
* app/tools/gimpscaletool.[ch]
|
||
* app/tools/gimpsheartool.[ch]: turned all info_dialog update
|
||
functions into GimpTransformTool::dialog_update() implementations
|
||
and don't call them from ::recalc(), also removed calls to
|
||
transform_bounding_box(); both functions are called by the parent
|
||
class now. Call gimp_transform_tool_recalc() when dialog values
|
||
were changed, not the tool's internal function.
|
||
Moved all static variables to the instance structs.
|
||
|
||
2004-08-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimpsheartool.[ch]: applied (modified) patch from Ari
|
||
Pollak which enables controlling the shear direction from the
|
||
dialog and changing the shear direction without hitting "Reset".
|
||
Fixes bug #149467.
|
||
|
||
Also moved all static variables to the GimpShearTool struct and
|
||
converted tabs to spaces.
|
||
|
||
2004-08-06 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/nova.c: ported to GimpPreviewArea.
|
||
|
||
2004-08-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* Made 2.1.3 release.
|
||
|
||
2004-08-06 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/polar.c: ported to GimpPreviewArea (from
|
||
GimpOldPreview).
|
||
|
||
2004-08-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpcolor/test-color-parser.c: include <glib-object.h>.
|
||
|
||
2004-08-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/depthmerge.c:
|
||
* plug-ins/common/despeckle.c: removed unused variables.
|
||
|
||
2004-08-06 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/flarefx.c: ported to GimpPreviewArea (from
|
||
GimpOldPreview)
|
||
|
||
2004-08-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/twain/Makefile.am (EXTRA_DIST): forgot to remove
|
||
tw_sess.c here.
|
||
|
||
2004-08-05 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/wind.c: ported to GimpPreviewArea (from
|
||
GimpOldPreview)
|
||
|
||
2004-08-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimpiscissorstool.c: increased the handle size from 8
|
||
to 9 pixels (which is the same as in the path tool) as suggested
|
||
in bug #134250.
|
||
|
||
2004-08-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpstatusbar.c: make the cursor coordinates label
|
||
insensitive when displaying out-of-image coordinates.
|
||
|
||
2004-08-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/config/gimprc-blurbs.h (INSTALL_COLORMAP_BLURB):
|
||
s/pseudocolor visuals/8-bit (256 colors) displays/.
|
||
Fixes bug #137078.
|
||
|
||
2004-08-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
Enabled previewing items without selecting them in all list and
|
||
grid views using mouse button 2. Implicitly enables previewing of
|
||
items in container popups and thus fixes bug #121011:
|
||
|
||
* app/widgets/gimppreview.c (gimp_preview_button_press_event)
|
||
* app/widgets/gimpcellrendererviewable.c
|
||
(gimp_cell_renderer_viewable_clicked): show the preview also on
|
||
mouse button 2 click.
|
||
|
||
* app/widgets/gimpcontainertreeview.c
|
||
(gimp_container_tree_view_button_press): dispatch mouse button 2
|
||
clicks to GimpCellRendererViewable, but don't select or change
|
||
anything in the tree_view.
|
||
|
||
Unrelated cleanup:
|
||
|
||
* app/widgets/gimppreview.c (gimp_preview_button_press_event):
|
||
don't offset bevent->x,y by widget->allocation.x,y before calling
|
||
gimp_preview_popup_show() ...
|
||
|
||
* app/widgets/gimppreview-popup.c (gimp_preview_popup_show):
|
||
... instead, do it here generically (check if the parent widget is
|
||
GTK_WIDGET_NO_WINDOW()).
|
||
|
||
2004-08-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimpintstore.c (gimp_int_store_add_empty):
|
||
allocate the empty_iter using g_new0(). Fixes valgrind warnings
|
||
about reads from uninitialized memory.
|
||
|
||
2004-08-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/context-actions.c: use GTK_STOCK_JUMP_TO for
|
||
all "Set" actions (like context-foreground-red-set).
|
||
|
||
2004-08-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimpscaletool.c
|
||
* app/tools/gimptransformtool.h: applied patch from Jordi Gay
|
||
(attached to bug #131111) which adds an aspect ratio spinbutton to
|
||
the scale dialog and keeps the aspect ratio intact when width or
|
||
height are changed using the dialog. Fixes bug #132274.
|
||
|
||
* app/tools/gimpcroptool.c
|
||
* app/tools/gimpscaletool.c: don't set the aspect spinbuttons to
|
||
"wrap" and decrease their climb_rate.
|
||
|
||
2004-08-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/context-actions.c
|
||
* app/actions/context-commands.[ch]
|
||
* menus/image-menu.xml.in: added actions, callbacks and menu items
|
||
for the brush shape and spikes.
|
||
|
||
2004-08-04 Simon Budig <simon@gimp.org>
|
||
|
||
* plug-ins/common/grid.c: changed the default colors for the
|
||
first invocation to the current foregroud color which is more
|
||
likely to be useful than the blue shades.
|
||
|
||
2004-08-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* themes/Default/images/Makefile.am
|
||
* themes/Default/images/stock-brush-generated-*-16.png: removed ...
|
||
|
||
* themes/Default/images/stock-shape-*-16.png: ... and added back
|
||
with more generic names.
|
||
|
||
* libgimpwidgets/gimpstock.[ch]
|
||
* app/widgets/gimpbrusheditor.c: changed accordingly.
|
||
|
||
* app/tools/gimpinkoptions-gui.c: use the new stock icons here as
|
||
well.
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpblobeditor.[ch]: added a simple blob shape
|
||
editor widget factored out of app/tools/gimpinkoptions-gui.c.
|
||
|
||
2004-08-04 Simon Budig <simon@gimp.org>
|
||
|
||
* app/core/gimpbrushgenerated.c: Enhanced the range of the hardness
|
||
parameter to make more soft brushes possible. Please note that this
|
||
makes existing generated brushes look more soft. But since people
|
||
apparently rarely use more than one or two generated brushes and
|
||
these get changed frequently I guess it should be OK.
|
||
|
||
2004-08-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
Allow URI drops from apps linked against GLib < 2.4.4 to GIMP
|
||
linked against GLib >= 2.4.5. Fixes bug #148140.
|
||
|
||
* app/core/gimp-utils.[ch]: added gimp_check_glib_version().
|
||
|
||
* app/widgets/gimpselectiondata.c: added runtime check for GLib
|
||
versions that encode file:// URIs correctly (>= 2.4.5). For older
|
||
(broken) GLibs, leave the code path as is, for newer (fixed) ones,
|
||
perform an additional check if the dropped URI is in the (broken)
|
||
escaped-UTF-8 format and convert it to local filename encoding.
|
||
|
||
* app/gui/gui.c: warn the user that non-ASCII filenames can't
|
||
be used when linked against GLib 2.4.4.
|
||
|
||
2004-08-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimp.[ch]: changed member "ProcRecord *last_plug_in"
|
||
to "PlugInProcDef *last_plug_in". Added function
|
||
gimp_set_last_plug_in() and signal Gimp::last-plug-in-changed.
|
||
|
||
* app/actions/plug-in-commands.c
|
||
* app/plug-in/plug-in-run.c: changed accordingly.
|
||
|
||
* app/actions/plug-in-actions.c: factored out updating of the
|
||
"Reshow Last" and "Rerun Last" actions to a private function.
|
||
Connect each "plug-in" action group to Gimp::last-plug-in-changed
|
||
and update the actions' label and sensitivity in the
|
||
callback. Fixes bug #149139.
|
||
|
||
2004-08-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimplayertreeview.c: #include "core/gimpimage-undo.h"
|
||
|
||
2004-08-04 Manish Singh <yosh@gimp.org>
|
||
|
||
* configure.in: Really really really really fix WINDRES logic.
|
||
|
||
2004-08-03 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/winicon/icodialog.c: ported to GimpPreviewArea. Still needs
|
||
work.
|
||
|
||
2004-08-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontainergridview.c
|
||
(gimp_container_grid_view_item_context): ref/unref the view around
|
||
the calls to gimp_container_view_item_selected() and _item_context()
|
||
because the former may destroy the view which leads to a crash
|
||
when trying the latter. Fixes bug #148955.
|
||
|
||
2004-08-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpimage-undo.[ch] (gimp_image_undo_can_compress):
|
||
new function which checks if undo compression is possible:
|
||
|
||
(1) is the image dirty? Fixes bug #148853.
|
||
(2) is redo stack empty?
|
||
(3) do both the passed undo object_type and undo_type
|
||
match the top undo item?
|
||
|
||
Consistently name the GType and GimpUndoType passed to undo
|
||
functions "object_type" and "undo_type" to avoid confusion.
|
||
|
||
* app/actions/layers-commands.c
|
||
* app/tools/gimpeditselectiontool.c
|
||
* app/tools/gimptexttool.c
|
||
* app/widgets/gimpitemtreeview.c
|
||
* app/widgets/gimplayertreeview.c: use the new utility function
|
||
instead of checking the above conditions manually.
|
||
|
||
2004-08-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpbrushgenerated.c (gimp_brush_generated_load): don't
|
||
leak the brush's name if parsing the shape fails.
|
||
|
||
(gimp_brush_generated_dirty): shut up bogus compiler warnings
|
||
about uninitialized variables.
|
||
|
||
2004-08-03 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/imagemap/imap_preview.c
|
||
* plug-ins/imagemap/imap_preview.h: ported to GimpPreviewArea.
|
||
|
||
2004-08-03 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/ifscompose/ifscompose.c: ported to GimpPreviewArea.
|
||
|
||
2004-08-03 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/fp/fp.c: converted to GimpPreviewArea.
|
||
|
||
2004-08-03 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/rcm/rcm_callback.c
|
||
* plug-ins/rcm/rcm_dialog.c
|
||
* plug-ins/rcm/rcm_misc.c: Ported to GimpPreviewArea.
|
||
|
||
2004-08-02 Simon Budig <simon@gimp.org>
|
||
|
||
* app/widgets/gimpbrusheditor.c: Fixed brush spacing for brushes
|
||
with >= 2 spikes. Spotted by Joao S. O. Bueno.
|
||
|
||
Fixes bug #149099.
|
||
|
||
2004-08-02 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/whirlpinch.c: ported to GimpPreviewArea.
|
||
|
||
2004-08-02 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/video.c: ported to GimpPreviewArea.
|
||
|
||
2004-08-02 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/unsharp.c: ported to GimpPreviewArea. Centered the
|
||
preview, too.
|
||
|
||
2004-08-01 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/tileit.c: ported to GimpPreviewArea.
|
||
|
||
2004-08-01 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/sinus.c: ported to GimpPreviewArea.
|
||
|
||
2004-08-01 Manish Singh <yosh@gimp.org>
|
||
|
||
* configure.in: Really really really fix WINDRES logic.
|
||
|
||
2004-08-01 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/common/mkgen.pl: update install-% rule to match newer
|
||
libtool commands.
|
||
|
||
* plug-ins/common/Makefile.am: regenerated.
|
||
|
||
2004-08-01 Manish Singh <yosh@gimp.org>
|
||
|
||
* configure.in: Really really fix WINDRES logic.
|
||
|
||
2004-08-01 Manish Singh <yosh@gimp.org>
|
||
|
||
* configure.in: Really fix WINDRES logic.
|
||
|
||
2004-08-01 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/scatter_hsv.c: ported to GimpPreviewArea.
|
||
|
||
2004-08-01 Hans Breuer <hans@breuer.org>
|
||
|
||
* app/display/makefile.msc app/widgets/makefile.msc : build
|
||
but *dont link* display-enums.obj, widget-enums.obj and
|
||
gimpdisplayoptions.obj. They must be in the dll
|
||
* app/makefile.msc : build gimp.exe and gimp-console.exe both
|
||
using the same gimp-core.dll
|
||
* app/gimpcore.def : new file, exports for gimp-core.dll
|
||
* app/Makefile.am : added to EXTRA_DIST
|
||
|
||
* cursors/makefile.msc : new file to create gimp-tool-cursors.h
|
||
* cursors/Makefile.am : added to EXTRA_DIST
|
||
|
||
* **/makefile.msc : updated
|
||
|
||
* app/main.c app/app_procs.c : moved code to close the console
|
||
from the former to the later. It only is to be used if The Gimp
|
||
is not build as console app.
|
||
|
||
* plug-ins/gfig/gfig.c : dont gimp_drawable_detach() the same
|
||
drawable twice
|
||
* plug-ins/gfig-dialog.c() : added a g_return_if_fail() to avoid
|
||
crashing on File/Import
|
||
|
||
2004-08-01 Simon Budig <simon@gimp.org>
|
||
|
||
* app/widgets/gimpbrusheditor.c: Fixed oversight that accidentially
|
||
reset the number of spikes to 2.
|
||
|
||
2004-08-01 Simon Budig <simon@gimp.org>
|
||
|
||
* app/core/gimpbrushgenerated.[ch]: Added optional spikes for
|
||
the generated brushes, enabling star shaped generated brushes.
|
||
|
||
* app/widgets/gimpbrusheditor.[ch]: GUI for this.
|
||
|
||
* app/core/gimpbrush.c: changed accordingly.
|
||
|
||
2004-08-01 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/mapcolor.c
|
||
* plug-ins/common/sample_colorize.c: ported to GimpPreviewArea.
|
||
|
||
* plug-ins/common/newsprint.c: ported to GimpPreviewArea, even though
|
||
it should use some pngs instead.
|
||
|
||
2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* configure.in: modified the checks. hopefully it works on all
|
||
platforms this time.
|
||
|
||
2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* configure.in: move an AM_CONDITIONAL out of an if block
|
||
|
||
2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* configure.in: added checks for windres. Fixes bug #148443
|
||
together with my last commit.
|
||
|
||
2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* app/Makefile.am: added checks and rules to build and link the
|
||
win32 icon resource if the resource compiler windres is found by
|
||
configure. First part of a fix for bug #148443.
|
||
|
||
2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* libgimpwidgets/gimpwidgets.def: added gimp_preview_area_fill
|
||
|
||
2004-08-01 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/flame/flame.c: ported to GimpPreviewArea.
|
||
|
||
2004-08-01 Simon Budig <simon@gimp.org>
|
||
|
||
* app/core/core-enums.h
|
||
* app/core/gimpbrushgenerated.[ch]: Implement three different
|
||
brush shapes for generated brushes.
|
||
|
||
* app/core/gimpbrush.c: changed accordingly.
|
||
* app/core/core-enums.c: regenerated.
|
||
|
||
* app/widgets/gimpbrusheditor.[ch]: Add toggles for the shape.
|
||
* themes/Default/images/stock-brush-generated-*-16.png: New stock
|
||
icons for the brush shapes.
|
||
|
||
* themes/Default/images/Makefile.am
|
||
* libgimpwidgets/gimpstock.[ch]: changed accordingly
|
||
|
||
untabified the files touched.
|
||
|
||
2004-08-01 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/iwarp.c: ported to GimpPreviewArea.
|
||
|
||
2004-07-31 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/gqbist.c: ported to GimpPreviewArea.
|
||
|
||
2004-07-31 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/fractaltrace.c: ported to GimpPreviewArea.
|
||
|
||
2004-07-31 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/exchange.c: ported to GimpPreviewArea.
|
||
|
||
2004-07-31 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/emboss.c: ported to GimpPreviewArea.
|
||
|
||
2004-07-31 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/diffraction.c: ported to GimpPreviewArea.
|
||
|
||
2004-07-31 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/despeckle.c: use even more GimpPreviewArea's
|
||
facilities.
|
||
|
||
* plug-ins/common/destripe.c: ported to GimpPreviewArea.
|
||
|
||
2004-07-31 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gflare/gflare.c: ported to GimpPreviewArea.
|
||
|
||
2004-07-31 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/despeckle.c: ported to GimpPreviewArea.
|
||
|
||
2004-07-31 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/brush.c
|
||
* plug-ins/gimpressionist/orientmap.c
|
||
* plug-ins/gimpressionist/paper.c
|
||
* plug-ins/gimpressionist/preview.c
|
||
* plug-ins/gimpressionist/size.c:
|
||
Converted the code from using GtkPreview to GimpPreviewArea.
|
||
|
||
2004-07-30 Seth Burgess <sjburges@gimp.org>
|
||
|
||
* plug-ins/common/gauss.c: added some non-interactive modes (if called
|
||
from the pdb with RUN_INTERACTIVE).
|
||
|
||
2004-07-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcolorselect.c: minor cleanup.
|
||
|
||
2004-07-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimppatternmenu.c: ported to GimpPreviewArea.
|
||
|
||
* libgimp/gimpbrushmenu.c: some small changes for consistency.
|
||
|
||
2004-07-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreviewarea.[ch]: added new function
|
||
gimp_preview_area_fill().
|
||
|
||
* libgimpwidgets/test-preview-area.c: added a test for new function.
|
||
|
||
* libgimp/gimpbrushmenu.c: ported to GimpPreviewArea.
|
||
|
||
2004-07-31 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/depthmerge.c: use a GimpPreviewArea instead of a
|
||
GtkPreview. Some code cleanup, too.
|
||
|
||
2004-07-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpmenu.c (gimp_menu_make_preview): use a GtkImage and
|
||
a GdkPixbuf instead of the deprecated GtkPreview widget.
|
||
|
||
2004-07-30 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/curve_bend.c: Use a GimpPreviewArea instead of
|
||
GtkPreview.
|
||
|
||
2004-07-30 Sven Neumann <sven@gimp.org>
|
||
|
||
Applied a bunch of small changes contributed by Tim Mooney to fix
|
||
stack corruption on Tru64 and Aix (bug #129867).
|
||
|
||
* app/Makefile.am
|
||
* plug-ins/script-fu/Makefile.am: changed the dependency order so
|
||
that $(REGEXREPL) is linked earlier.
|
||
|
||
* regexrepl/regex.[ch]: fixed check for __STDC__, merged upstream
|
||
fix for re_max_failures value.
|
||
|
||
2004-07-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* configure.in: always do the check for perl and use the
|
||
substituted perl executable name in the call for gimp-mkenums.
|
||
Fixes the build on platforms where perl is not available as
|
||
/usr/bin/perl. Closes bug #148813.
|
||
|
||
* app/widgets/gimpenumstore.c: added missing include.
|
||
|
||
2004-07-30 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/channel_mixer.c: GtkPreview->GtkDrawingArea, plus
|
||
some minor code cleanups.
|
||
|
||
2004-07-30 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/CML_explorer.c: Transformed one GtkPreview to a
|
||
GimpPreviewArea and the other to a simple GtkDrawingArea, since this
|
||
makes the code simpler.
|
||
|
||
2004-07-30 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* libgimpwidgets/gimppreviewarea.c (gimp_preview_area_draw):
|
||
corrected a typo causing mayhem in previews of non-alpha grayscale
|
||
images. Fixes bug #148873.
|
||
|
||
2004-07-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/ccanalyze.c (fillPreview): optimized preview
|
||
filling a little bit, removed trailing whitespace.
|
||
|
||
2004-07-30 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/ccanalyze.c: converted to use a GimpPreviewArea,
|
||
and some small cleanups (g_malloc to g_new, removing tabs)
|
||
|
||
2004-07-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreviewarea.c (gimp_preview_area_draw):
|
||
optimized alpha blending.
|
||
|
||
2004-07-30 Sven Neumann <sven@gimp.org>
|
||
|
||
Applied a bunch of AIX portability fixes (bug #148813):
|
||
|
||
* configure.in: when testing for Xmu library, link with -lXt -lX11.
|
||
|
||
* app/gui/tips-parser.c
|
||
* app/gui/user-install-dialog.c
|
||
* app/tools/tools-enums.h
|
||
* app/widgets/gimpdasheditor.c
|
||
* app/widgets/widgets-enums.h
|
||
* libgimpthumb/gimpthumb-error.h
|
||
* libgimpwidgets/gimpcolorbutton.c
|
||
* plug-ins/common/edge.c: removed trailing commas from enums.
|
||
|
||
* plug-ins/common/snoise.c: renamed defines to avoid collision
|
||
with system headers.
|
||
|
||
* plug-ins/imagemap/imap_cmd_move.c: no C++ style comments.
|
||
|
||
* app/paint-funcs/paint-funcs-generic.h
|
||
* app/paint-funcs/paint-funcs.c: use integers for bit fields.
|
||
|
||
2004-07-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/bumpmap.c: removed preview code that isn't used
|
||
any longer.
|
||
|
||
2004-07-30 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/common/bumpmap.c: use GimpPreviewArea instead of
|
||
GtkPreview (which leads to much simpler code)
|
||
|
||
2004-07-29 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppreviewarea.c: only invalidate the buffer
|
||
on size_allocate; allocate a new one on the next call to
|
||
gimp_preview_area_draw(). Fixed buffer offset in expose method.
|
||
|
||
* libgimpwidgets/Makefile.am
|
||
* libgimpwidgets/test-preview-area.c: more a benchmark than a
|
||
test; quite similar to testrgb from the GTK+ source tree.
|
||
|
||
2004-07-29 DindinX <david@dindinx.org>
|
||
|
||
* plug-ins/FractalExplorer/Dialogs.c: converted all GtkPreview
|
||
widgets to GimpPreviewArea.
|
||
|
||
2004-07-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpmodule/gimpmoduledb.c: converted tabs to spaces, removed
|
||
unused #if 0'ed prototype and unused #includes, minor cleanups.
|
||
|
||
2004-07-29 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/*.[ch]: normalized the names of the fields
|
||
of gimpressionist_vals_t.
|
||
|
||
2004-07-29 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/Makefile.am
|
||
* libgimpwidgets/gimpwidgets.def
|
||
* libgimpwidgets/gimpwidgets.h
|
||
* libgimpwidgets/gimpwidgetstypes.h
|
||
* libgimpwidgets/gimppreviewarea.[ch]: added GimpPreviewArea, a
|
||
replacement for GtkPreview, loosely based on patches from Geert
|
||
Jordaens and David Odin. Fixes bug #144759.
|
||
|
||
* plug-ins/common/sharpen.c: use the new widget instead of a
|
||
GtkPreview; saves about 100 lines of rather complex code :)
|
||
|
||
2004-07-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
* etc/controllerrc: changed default configuration of the keyboard
|
||
controller: scroll the display one step on cursor_key, scroll by
|
||
one page on <shift>+cursor_key and scroll to top/bottom/left/right
|
||
on <control>+cursor_key. Fixes bug #53988.
|
||
|
||
Moved the old opacity-modifying actions to <alt>+cursor_key.
|
||
|
||
2004-07-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
Replaced the concept of having a boolean indicating if an undo
|
||
step dirties the image by a bitfield indicating which parts
|
||
of the image are dirtied:
|
||
|
||
* app/core/core-enums.[ch]: reordered two values in enum
|
||
GimpUndoType, added GIMP_DIRTY_IMAGE_SIZE to enum GimpDirtyMask.
|
||
|
||
The values of GimpDirtyMask are still questionable and will
|
||
probably change...
|
||
|
||
* app/core/gimpimage.[ch]: removed signal "undo_start" and added
|
||
a GimpDirtyMask parameter to the "dirty" and "clean" signals.
|
||
|
||
* app/core/gimpimage-undo.[ch] (gimp_image_undo_push): replaced
|
||
"gboolean dirties_image" by "GimpDirtyMask dirty_mask" and pass
|
||
it to gimp_image_dirty().
|
||
|
||
(gimp_image_undo_group_start): added *ugly* code which tries to
|
||
figure GimpDirtyMask from the group's GimpUndoType and store it in
|
||
the GimpUndoGroup. Call gimp_image_dirty() instead of the removed
|
||
gimp_image_undo_start(). This means the undo group now dirties the
|
||
image just like one of its undo steps, but that's no problem since
|
||
undoing cleans it in the same way.
|
||
|
||
* app/core/gimpundo.[ch]: s/dirties_image/dirty_mask/g
|
||
|
||
(gimp_undo_pop): emit clean/dirty signals *before* performing the
|
||
actual undo step so listeners can detach from the image before it
|
||
is changed by undo.
|
||
|
||
* app/core/gimpimage-undo-push.c (gimp_image_undo_push_*): pass a
|
||
GimpDirtyMask instead of TRUE/FALSE to gimp_image_undo_push().
|
||
|
||
* app/core/gimpimagemap.[ch]: removed "gboolean interactive"
|
||
because it makes no sense to use GimpImageMap noninteractively.
|
||
Don't freeze()/thaw() undo while the image_map is active which
|
||
fixes many ways of trashing the image's undo state but probably
|
||
introduces new ways of doing evil things.
|
||
|
||
* app/display/gimpdisplay-foreach.c
|
||
* app/display/gimpdisplayshell-handlers.c: changed according
|
||
to the GimpImage::clean()/dirty() signal changes. Small fixes
|
||
in the quit dialog's dirty image container.
|
||
|
||
* app/tools/gimptoolcontrol.[ch]: added member and API to
|
||
set/get the dirty_mask.
|
||
|
||
* app/tools/gimpcroptool.c
|
||
* app/tools/gimpimagemaptool.c
|
||
* app/tools/gimpiscissorstool.c
|
||
* app/tools/gimptexttool.c
|
||
* app/tools/gimptransformtool.c: whenever setting "preserve" to
|
||
FALSE, also set a "dirty_mask" which specifies on which image
|
||
changes the tool wants to be canceled.
|
||
|
||
* app/tools/tool_manager.c: removed "undo_start" connection and
|
||
connect to both "dirty" *and* "clean" to check if the active_tool
|
||
needs to be canceled. Cancel the tool only if the dirty_mask
|
||
passed in the signal has common bits with the tool's dirty_mask.
|
||
|
||
Fixes bug #109561 and probably opens some new ones...
|
||
|
||
2004-07-29 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* libgimp/gimp.def
|
||
* libgimp/gimpui.def: added some missing symbols
|
||
|
||
2004-07-29 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpbase/gimpbase.def: added new symbols.
|
||
|
||
2004-07-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
Added support for motion event history as provided by some input
|
||
device drivers. If you have a tablet driver supporting this,
|
||
please try and report back.
|
||
|
||
* app/display/gimpdisplayshell.h (struct GimpDisplayShell): added
|
||
member "guint32 last_motion_time".
|
||
|
||
* app/display/gimpdisplayshell-callbacks.c
|
||
(gimp_display_shell_tool_events): remember the last_motion_time on
|
||
button_press() and after motion() and ask the current device for
|
||
its motion history; in motion(), if the active_tool asks for exact
|
||
motions, check if the input device recorded a motion history and
|
||
process the history instead of the motion event.
|
||
|
||
(gimp_display_shell_get_time_coords): new utility function which
|
||
gets GimpCoords from a GdkTimeCoord struct as used by the motion
|
||
history.
|
||
|
||
2004-07-29 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/repaint.c: converted a multiple if into
|
||
a nested one.
|
||
|
||
2004-07-29 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/core-enums.h: removed enums GimpImageType and
|
||
GimpImageBaseType ...
|
||
|
||
* libgimpbase/gimpbaseenums.h: ... and added them here. Also moved
|
||
all enums from gimpbasetypes.h to this new file.
|
||
|
||
* libgimpbase/Makefile.am
|
||
* tools/pdbgen/Makefile.am: changed accordingly.
|
||
|
||
* app/core/core-enums.c
|
||
* libgimp/gimpenums.h
|
||
* libgimpbase/gimpbaseenums.c
|
||
* tools/pdbgen/enums.pl: regenerated.
|
||
|
||
* libgimpbase/gimpparasite.c
|
||
* libgimpbase/gimpprotocol.c
|
||
* libgimp/gimp.c: include <glib-object.h>
|
||
|
||
* libgimpbase/gimpbasetypes.[ch]: added API to set and get a
|
||
translation domain on a GType. This is used for translatable enum
|
||
values.
|
||
|
||
* libgimpbase/gimputils.[ch]: added API to retrieve the translated
|
||
name for an enum value.
|
||
|
||
* app/widgets/gimpenumstore.c
|
||
* app/widgets/gimpenumwidgets.c: use the new API in libgimpbase.
|
||
|
||
2004-07-29 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpdrawable.c: fixed gtk-doc comments.
|
||
|
||
2004-07-29 Dave Neary <bolsh@gimp.org>
|
||
|
||
* app/core/gimpdrawable-transform.c: Stop signed ints overflowing
|
||
while getting the mean by replacing (a + b) / 2 with a / 2 + b / 2.
|
||
Fixes bug #128594 for drawables less than 32K wide.
|
||
|
||
2004-07-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/gui/preferences-dialog.c: renamed "Cleared saved foobar now"
|
||
buttons to "Reset saves foobar to default values". Fixes bug #5673.
|
||
Added mnemonics for all the configure/save/reset buttons.
|
||
|
||
2004-07-29 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-scripts.c (script_fu_free_script):
|
||
applied patch by Kevin Cozens that moves a g_free() to the right
|
||
place (bug #148729).
|
||
|
||
2004-07-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/actions.c (action_groups): register the
|
||
GIMP_STOCK_VISIBLE icon with the "view" action group.
|
||
|
||
2004-07-28 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/brush.c: removed a redundant parameter
|
||
from one of the internal functions.
|
||
* plug-ins/gimpressionist/utils.c: Made sure that resources that
|
||
are selected by the presets will position their list views
|
||
accordingly.
|
||
|
||
2004-07-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* autogen.sh: if the check for libtoolize fails, try glibtoolize.
|
||
|
||
2004-07-28 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/presets.c: created a base function for
|
||
two functions with duplicate code.
|
||
|
||
2004-07-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/imagemap/imap_default_dialog.c: no need to include
|
||
"libgimp/stdplugins-intl.h" here.
|
||
|
||
2004-07-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/gui/preferences-dialog.c (prefs_dialog_new): reordered
|
||
buttons in the Interface -> Keyboard Shortcuts section to be
|
||
consistent with other sections which provide configure/save/clear
|
||
buttons.
|
||
|
||
2004-07-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimpbycolorselecttool.c (gimp_by_color_select_tool_init)
|
||
* app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_init):
|
||
don't call gimp_tool_control_set_preserve (tool->control, FALSE)
|
||
because these tools don't cache any image state and don't care
|
||
about the image changing under their feet.
|
||
|
||
2004-07-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell.c (gimp_display_shell_reconnect):
|
||
emit "reconnect" *before* emitting scale and scroll events so
|
||
listeners (the navigation view) can switch to the new image at the
|
||
right time.
|
||
|
||
2004-07-28 Sven Neumann <sven@gimp.org>
|
||
|
||
Applied a patch from Brion Vibber that makes the TWAIN plug-in
|
||
available on Mac OS X (bug #147962):
|
||
|
||
* configure.in
|
||
* plug-ins/Makefile.am: check for Mac OS X twain support.
|
||
|
||
* plug-ins/twain/Makefile.am
|
||
* plug-ins/twain/tw_local.h
|
||
* plug-ins/twain/tw_mac.c
|
||
* plug-ins/twain/tw_platform.h
|
||
* plug-ins/twain/tw_win.c: new files with platform specific code.
|
||
|
||
* plug-ins/twain/README
|
||
* plug-ins/twain/tw_dump.[ch]
|
||
* plug-ins/twain/tw_func.[ch]
|
||
* plug-ins/twain/tw_util.[ch]
|
||
* plug-ins/twain/twain.c: changed accordingly.
|
||
|
||
* plug-ins/twain/gimp-twain.png: twain application icon used by
|
||
the Mac port.
|
||
|
||
* plug-ins/twain/tw_sess.c: removed, doesn't seem to be used.
|
||
|
||
2004-07-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/image.pdb (image_is_dirty): fix typo in
|
||
parameter description.
|
||
|
||
* app/pdb/image_cmds.c
|
||
* libgimp/gimpimage_pdb.c: regenerated.
|
||
|
||
2004-07-28 DindinX <david.odin@cpe.fr>
|
||
|
||
* plug-ins/common/unsharp.c: Added a toggle button to enable/disable
|
||
preview updating. Should fix #144972.
|
||
|
||
2004-07-28 DindinX <david.odin@cpe.fr>
|
||
|
||
* plug-ins/common/shift.c
|
||
* plug-ins/common/sinus.c
|
||
* plug-ins/common/snoise.c
|
||
* plug-ins/common/spheredesigner.c: added missing calls to
|
||
g_rand_free (), remove tabs while I was at it.
|
||
|
||
* plug-ins/common/smooth_palette.c: minor cleanup
|
||
|
||
* plug-ins/common/spread.c: removed tabs.
|
||
|
||
2004-07-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/core-enums.h: added still unused flags type
|
||
GimpDirtyMask.
|
||
|
||
* app/base/Makefile.am
|
||
* app/core/Makefile.am
|
||
* app/display/Makefile.am
|
||
* app/paint/Makefile.am
|
||
* app/text/Makefile.am
|
||
* app/tools/Makefile.am
|
||
* app/widgets/Makefile.am
|
||
* libgimpthumb/Makefile.am: changed calls to gimp-mkenums to
|
||
support GTypeFlags and to make the value arrays private to the
|
||
get_type() functions.
|
||
|
||
* app/base/base-enums.c
|
||
* app/core/core-enums.c
|
||
* app/display/display-enums.c
|
||
* app/paint/paint-enums.c
|
||
* app/text/text-enums.c
|
||
* app/tools/tools-enums.c
|
||
* app/widgets/widgets-enums.c: regenerated.
|
||
|
||
2004-07-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint/gimpclone.c: converted tabs to spaces.
|
||
|
||
2004-07-28 DindinX <david.odin@cpe.fr>
|
||
|
||
* plug-ins/common/spread.c: fix a smallish memory leak.
|
||
|
||
2004-07-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/gimp-mkenums: synced with glib-mkenums (execept for the
|
||
newly added template feature).
|
||
|
||
2004-07-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimp/gimpbrushselect.c
|
||
* libgimp/gimpfontselect.c
|
||
* libgimp/gimpgradientselect.c
|
||
* libgimp/gimppalettemenu.c
|
||
* libgimp/gimppaletteselect.c
|
||
* libgimp/gimppatternselect.c (gimp_*_select_destroy): don't
|
||
leak the selected object's name and its data (brush mask etc).
|
||
|
||
* libgimp/gimpfontmenu.c: moved the icon to the left side of the
|
||
button.
|
||
|
||
* libgimp/gimppalettemenu.c: ditto. Added "Since: GIMP 2.2" to
|
||
API docs.
|
||
|
||
2004-07-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpactiongroup.c
|
||
(gimp_action_group_set_action_label): forgot to strip mnemonics
|
||
here.
|
||
|
||
2004-07-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
Enabled disabling all menu mnemonics. Addresses bug #120034:
|
||
|
||
* app/config/gimpguiconfig.[ch]
|
||
* app/config/gimprc-blurbs.h: added boolean RESTART property
|
||
"menu-menonics".
|
||
|
||
* app/gui/preferences-dialog.c: added a GUI for it.
|
||
|
||
* app/widgets/gimpactiongroup.[ch]: added boolean CONSTRUCT_ONLY
|
||
property "mnemonics".
|
||
|
||
(gimp_action_group_add_*_actions): call gimp_strip_uline() on
|
||
the actions' labels if mnemonics is FALSE.
|
||
|
||
* app/widgets/gimpactionfactory.[ch]
|
||
* app/actions/actions.c: pass gui_config->menu_menmonics to
|
||
all action groups.
|
||
|
||
2004-07-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* menus/image-menu.xml.in: commented out "Context" menu now that
|
||
we have a shortcut editor.
|
||
|
||
2004-07-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpgradient-load.c: don't leak empty SVG gradients.
|
||
|
||
2004-07-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/image-commands.c: include "libgimpbase/gimpbase.h",
|
||
not an individual header out of libgimpbase.
|
||
|
||
2004-07-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpbase/Makefile.am
|
||
* libgimpbase/gimpbase.h
|
||
* libgimpbase/gimpbase.def
|
||
* libgimpbase/gimpmemsize.[ch]: added new files with memsize
|
||
related functions (moved here from gimputil.c) and
|
||
GIMP_TYPE_MEMSIZE (moved here from app/config/gimpconfig-types.[ch]).
|
||
|
||
* libgimpbase/gimputils.[ch]: removed gimp_memsize_to_string() here.
|
||
|
||
* libgimpbase/gimpunit.[ch]: added GIMP_TYPE_UNIT (moved here from
|
||
app/config/gimpconfig-types.[ch]).
|
||
|
||
* libgimpbase/gimpbase-private.c
|
||
* libgimp/gimptile.c
|
||
* libgimp/gimpunitcache.c
|
||
* plug-ins/help/domain.c
|
||
* app/xcf/xcf-read.c: need to include glib-object.h.
|
||
|
||
* plug-ins/common/uniteditor.c: use GIMP_TYPE_UNIT.
|
||
|
||
* app/config/gimpconfig-types.[ch]: removed code that lives in
|
||
libgimpbase now.
|
||
|
||
* app/config/gimpconfig-deserialize.c: changed accordingly.
|
||
|
||
* app/config/gimpbaseconfig.c
|
||
* app/config/gimpdisplayconfig.c
|
||
* app/core/gimpcontext.c
|
||
* app/gui/grid-dialog.c
|
||
* app/tools/gimpcolortool.c
|
||
* app/widgets/gimpaction.c
|
||
* app/widgets/gimpunitstore.c: no need to include gimpconfig-types.h
|
||
any longer.
|
||
|
||
004-07-27 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimp/Makefile.am
|
||
* libgimp/gimp.h
|
||
* libgimp/gimpui.h
|
||
* libgimp/gimppalettemenu.[ch]
|
||
* libgimp/gimppaletteselect.[ch]: added palette select wrapper and
|
||
widget (straight copy & string replace of the font select stuff).
|
||
Fixes bug #136130.
|
||
|
||
* plug-ins/script-fu/script-fu-enums.h
|
||
* plug-ins/script-fu/script-fu-scripts.c
|
||
* plug-ins/script-fu/siod-wrapper.c: added SF_PALETTE so it can
|
||
be used in scripts.
|
||
|
||
* plug-ins/script-fu/scripts/test-sphere.scm: added a palette
|
||
parameter to the test script.
|
||
|
||
2004-07-27 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpimage.c (gimp_image_finalize): remove the image
|
||
from the image hash table and set its "gimp" pointer to NULL
|
||
*after* all layers, channels, vectors and the selection are
|
||
finalized; otherwise these items have no chance of removing
|
||
themselves from the item hash table (because image->gimp is
|
||
already NULL). Spotted by pgimeno and nomis.
|
||
(should be backported after it got some testing)
|
||
|
||
2004-07-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpfiledialog.c (gimp_file_dialog_new): string change.
|
||
|
||
2004-07-27 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): make
|
||
sure we always set a non-null URI.
|
||
|
||
2004-07-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimphelp-ids.h removed unused help IDs
|
||
GIMP_HELP_FILE_OPEN_XCF and GIMP_HELP_FILE_SAVE_XCF. The help IDs
|
||
for these entries are generated from the procedure names.
|
||
|
||
2004-07-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimphelp.c (gimp_help): print the help-id and
|
||
help-domain to stdout if gimp was started with the --verbose
|
||
command-line option.
|
||
|
||
2004-07-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
|
||
show extensions in the filters menu. Is this a good idea at all?
|
||
|
||
2004-07-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpbrushmenu.c
|
||
* libgimp/gimppatternmenu.c: attempt to make the brush and pattern
|
||
selectors look less like buttons (supposed to fix bug #147777).
|
||
|
||
2004-07-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcolorhexentry.c (gimp_color_hex_entry_events):
|
||
also accept the short hexadecimal notation (3 hex digits).
|
||
|
||
2004-07-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/Makefile.am (libgimpwidgetsinclude_HEADERS):
|
||
added new files.
|
||
|
||
2004-07-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/gimpcellrenderertoggle.[ch]: moved to libgimpwidgets.
|
||
|
||
* app/widgets/gimpcomponenteditor.c
|
||
* app/widgets/gimpcontainertreeview.c
|
||
* app/widgets/gimpitemtreeview.c
|
||
* app/widgets/gimplayertreeview.c
|
||
* app/widgets/gimptoolview.c
|
||
* app/widgets/widgets-types.h: changed accordingly.
|
||
|
||
* libgimpwidgets/Makefile.am
|
||
* libgimpwidgets/gimpwidgets.def
|
||
* libgimpwidgets/gimpwidgets.h
|
||
* libgimpwidgets/gimpwidgetsmarshal.list
|
||
* libgimpwidgets/gimpwidgetstypes.h
|
||
* libgimpwidgets/gimpcellrenderertoggle.[ch]: custom toggle cell
|
||
renderer moved here from app/widgets.
|
||
|
||
* libgimpwidgets/gimpcellrenderercolor.[ch]: unified code with the
|
||
new toggle cell renderer.
|
||
|
||
2004-07-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/pdb/procedural_db.[ch] (procedural_db_free_data): new
|
||
function which clears the whole list of data set by plug-ins.
|
||
|
||
(procedural_db_free): use it.
|
||
|
||
* app/actions/plug-in-actions.c
|
||
* app/actions/plug-in-commands.[ch]: added action, callback and
|
||
confirmation dialog for "Reset all filters to default values".
|
||
Somehow addresses bug #81015.
|
||
|
||
* app/widgets/gimphelp-ids.h: added a help ID for the new action.
|
||
|
||
* menus/image-menu.xml.in: added it to the "Filters" submenu.
|
||
|
||
2004-07-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcellrenderercolor.c
|
||
(gimp_cell_renderer_color_get_size): fine-tuning.
|
||
|
||
2004-07-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/config/gimpconfig-types.h: removed GIMP_TYPE_COLOR.
|
||
|
||
* app/config/gimpconfig-params.[ch]: renamed GimpParamSpecColor
|
||
to GimpParamSpecRGB.
|
||
|
||
* app/config/gimpconfig-deserialize.c
|
||
* app/config/gimpconfig-dump.c
|
||
* app/config/gimpconfig-serialize.c
|
||
* app/config/gimpscanner.c
|
||
* app/core/gimp-utils.c
|
||
* app/core/gimpcontext.c
|
||
* app/core/gimpgrid.c
|
||
* app/display/gimpdisplayoptions.c
|
||
* app/text/gimptext.c
|
||
* app/tools/gimpcolortool.c
|
||
* app/widgets/gimpaction.c
|
||
* app/widgets/gimpcolorbar.c
|
||
* app/widgets/gimppropwidgets.c: changed accordingly.
|
||
|
||
2004-07-26 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/: added a de-allocation to the PPM's
|
||
allocated by the size map dialog.
|
||
|
||
2004-07-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpgradient-load.c: load all linear gradients from an
|
||
SVG file, not only the first one.
|
||
|
||
2004-07-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpdatafactory.h: added "gboolean writable" to the
|
||
GimpDataFactoryLoaderEntry struct. Return a GList* instead of
|
||
GimpData* from GimpDataLoadFunc so it's possible to load more than
|
||
one data object from one file.
|
||
|
||
* app/core/gimpdatafactory.c (gimp_data_factory_load_data):
|
||
changed accordingly: add all items of the returned lists to the
|
||
data factory. Make the data object writable only if it's in the
|
||
writable path *and* its loader entry says it's a writable format
|
||
*and* the returned list contains exactly one element.
|
||
|
||
* app/core/gimp.c (gimp_real_initialize): declare all loader
|
||
entries as writable where we have code to read and write exactly
|
||
one object per file; all others are not writable.
|
||
|
||
* app/core/gimpbrush.[ch]
|
||
* app/core/gimpbrushgenerated.[ch]
|
||
* app/core/gimpbrushpipe.[ch]
|
||
* app/core/gimpgradient-load.[ch]
|
||
* app/core/gimppalette.[ch]
|
||
* app/core/gimppattern.[ch] (all load functions): return a list
|
||
containing the loaded object instead of the object itself.
|
||
|
||
2004-07-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/Makefile.am
|
||
* libgimpwidgets/gimpwidgets.def
|
||
* libgimpwidgets/gimpwidgets.h
|
||
* libgimpwidgets/gimpwidgetstypes.h
|
||
* libgimpwidgets/gimpcellrenderercolor.[ch]: added a GimpRGB cell
|
||
renderer.
|
||
|
||
* libgimpwidgets/gimpcolorarea.[ch]: exported the function that
|
||
renders the color to a buffer for internal use in libgimpwidgets.
|
||
|
||
* libgimpwidgets/gimpcolorhexentry.c: use the new cell renderer
|
||
for the completion popup.
|
||
|
||
2004-07-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpcolor/gimpcolor.def
|
||
* libgimpwidgets/gimpwidgets.def: added new symbols.
|
||
|
||
2004-07-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpcolor/gimprgb.[ch]: register GimpRGB as a boxed type.
|
||
|
||
* libgimpcolor/gimpadaptivesupersample.c
|
||
* libgimpcolor/gimpcolorspace.c
|
||
* libgimpcolor/gimprgb-parse.c
|
||
* libgimp/gimp.h: include <glib-object.h> instead of <glib.h>.
|
||
|
||
2004-07-26 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/: placed all the orientation map-related
|
||
public functions in orientmap.h. Now we're freeing the PPM's that it
|
||
is allocating by a call to orientation_map_free_resources().
|
||
|
||
2004-07-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/core-types.h: removed unused typedef
|
||
GimpDataObjectLoaderFunc.
|
||
|
||
2004-07-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpcolor/gimprgb-parse.c
|
||
* libgimpcolor/gimprgb.h: added new function gimp_rgb_list_names()
|
||
that gives access to the list of SVG color keywords.
|
||
|
||
* libgimpwidgets/Makefile.am
|
||
* libgimpwidgets/gimpwidgets.h
|
||
* libgimpwidgets/gimpwidgetstypes.h
|
||
* libgimpwidgets/gimpcolorhexentry.[ch]: added new widget that
|
||
allows to enter colors in hex notation or by using color names.
|
||
|
||
* libgimpwidgets/gimpcolorscales.c: use a GimpColorHexEntry.
|
||
|
||
2004-07-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimpeditselectiontool.[ch]: renamed init_edit_selection()
|
||
to gimp_edit_selection_tool_start(). Removed enum EditType.
|
||
|
||
* app/tools/tools-enums.h: added enum GimpTranslateMode instead.
|
||
|
||
* app/tools/gimpmovetool.c: changed accordingly.
|
||
|
||
* app/tools/gimpselectiontool.[ch]: added protected utility
|
||
function gimp_selection_tool_start_edit().
|
||
|
||
* app/tools/gimpfreeselecttool.c
|
||
* app/tools/gimpfuzzyselecttool.c
|
||
* app/tools/gimprectselecttool.c: use the new function instead of
|
||
duplicating the same code three times, don't include
|
||
"gimpeditselectiontool.h".
|
||
|
||
* app/tools/gimpiscissorstool.c: don't include
|
||
"gimpeditselectiontool.h".
|
||
|
||
2004-07-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimpeditselectiontool.c: don't freeze()/thaw() the
|
||
image's undo to prevent live-movement from ending up on the undo
|
||
stack. Instead, just stop pushing undo steps after the initial
|
||
movement. Simplifies edit_select's undo code quite a bit and fixes
|
||
bug #148458.
|
||
|
||
2004-07-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcolorscales.c (gimp_color_scales_hex_events):
|
||
accept SVG color names in the hex entry. Not very intuitive but
|
||
probably a nice experts feature and it can be improved later.
|
||
|
||
2004-07-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/main.c (main): use #ifdef GIMP_UNSTABLE instead of looking
|
||
at GIMP_MINOR_VERSION.
|
||
|
||
* app/app_procs.c: don't #include "tools/gimp-tools.h".
|
||
|
||
2004-07-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/bmp/bmp.h
|
||
* plug-ins/bmp/bmpread.c: applied a patch by Brion Vibber that
|
||
fixes extra data overflow, nonstandard 16bpp field arrangement
|
||
and unrecognized compression (bug #143682).
|
||
|
||
2004-07-25 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/common/decompose.c: clamp results of LAB decomposition
|
||
so that out-of-gamut conversions do not overflow and get badly
|
||
distorted. Fixes bug #147603. Note that it would probably be a
|
||
good idea to do similar things for other conversion types.
|
||
|
||
2004-07-25 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/: converted checks for initialization of
|
||
ppm's done by checking the "col" buffer, to macro calls.
|
||
|
||
2004-07-25 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/: fixed bug #148088: ("Gimpressioinst
|
||
crashes if given malicious presets with out of range values, in
|
||
the radio buttons group numeric values: "placetype", "orienttype",
|
||
etc. ").
|
||
|
||
This was done by adding clamps to the relevant values in the preset.
|
||
|
||
2004-07-25 Raphaël Quinet <quinet@gamers.org>
|
||
|
||
* INSTALL: Minor fixes and improvements. Suggest using a
|
||
different prefix and setting PKG_CONFIG_LIBDIR if old versions of
|
||
GTK+ libs are found and cannot be removed without breaking other
|
||
packages.
|
||
|
||
2004-07-23 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/: created a header "orientation.h"
|
||
for the Orientation tab specific declarations.
|
||
|
||
2004-07-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimppixbuf.c (gimp_pixbuf_from_data): added missing code
|
||
for grayscale previews.
|
||
|
||
2004-07-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpgradient-load.c (svg_parser_end_element): fixed
|
||
handling of the last gradient segment and did some code cleanup.
|
||
|
||
2004-07-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpgradient-load.c (gimp_gradient_load_svg): improved
|
||
error message.
|
||
(svg_parser_end_element): don't crash on empty gradient definitions.
|
||
|
||
2004-07-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpcolor/test-color-parser.c: added more test samples.
|
||
|
||
* libgimpcolor/gimprgb-parse.c: fixed a bug that I found with the
|
||
new tests.
|
||
|
||
* app/core/gimpgradient-load.c: changed SVG parser to handle
|
||
gradients that are defined more deeply in the SVG hierarchy. Added
|
||
a simplistic CSS style parser to deal with gradient definitions
|
||
that use CSS to define the gradient stop properties (closes bug
|
||
#148127).
|
||
|
||
2004-07-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpdatafactory.c: some newlines to improve error
|
||
messages.
|
||
|
||
* app/core/gimpgradient-load.c (gimp_gradient_load_svg): fixed
|
||
error handling.
|
||
|
||
2004-07-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpcolor/Makefile.am
|
||
* libgimpcolor/test-color-parser.c: added a simple unit test
|
||
framework for the color parser.
|
||
|
||
* libgimpcolor/gimprgb-parse.c: fixed parsing of rgba() values.
|
||
|
||
* libgimpmath/test-md5.c: minor cleanup.
|
||
|
||
2004-07-23 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpcolor/gimprgb-parse.c (gimp_rgba_parse_css): added support
|
||
for the "transparent" color name.
|
||
|
||
2004-07-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpcolor/gimprgb-parse.c
|
||
* libgimpcolor/gimprgb.h: improved the CSS color parser code,
|
||
added new function gimp_rgba_parse_css(), added support for HSL
|
||
color values.
|
||
|
||
2004-07-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpcolor/gimprgb-parse.c
|
||
* libgimpcolor/gimprgb.h: use a signed integer to pass the string
|
||
length to the new parser functions. The API explicitely asks for
|
||
-1 to be passed...
|
||
|
||
* app/core/gimp.c
|
||
* app/core/gimpgradient-load.[ch]
|
||
* app/core/gimpgradient.h: added preliminary support for loading
|
||
simple SVG gradients (see bug #148127). Be careful with this new
|
||
feature; editing the loaded gradient will cause the SVG file to be
|
||
overwritten! Work in progress...
|
||
|
||
2004-07-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/Makefile.am
|
||
* app/core/gimpgradient-load.[ch]
|
||
* app/core/gimpgradient-save.[ch]
|
||
* app/core/gimpgradient.[ch]: moved gradient file handling out of
|
||
gimpgradient.c to new files.
|
||
|
||
* app/core/gimp.c
|
||
* app/actions/gradients-commands.c: changed accordingly.
|
||
|
||
* libgimpcolor/gimpcolor.def: added gimp_rgb_parse_name.
|
||
|
||
2004-07-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* data/misc/gimp.desktop.in.in (MimeType): image/g -> image/g3fax.
|
||
|
||
2004-07-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpactionview.c: rephrased the text for the dialog
|
||
that appears if a new shortcut collides with an existing one.
|
||
|
||
* libgimpcolor/gimprgb.[ch]: added new function gimp_rgb_parse_name()
|
||
which accepts RGB colors in hexadecimal notation or as SVG color
|
||
keywords.
|
||
|
||
2004-07-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell.c (gimp_display_shell_resume):
|
||
s/pause/resume/ in the API docs.
|
||
|
||
2004-07-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/gimp-remote.c (main): correctly convert relative paths to
|
||
URIs. Append the resulting URI only if it's not NULL.
|
||
|
||
2004-07-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimptoolbox.c (toolbox_create_tools): connect to
|
||
"accel-changed" of the accel_group using connect_object(), not
|
||
just connect() so we don't crash when it's emitted after the
|
||
toolbox is destroyed.
|
||
|
||
2004-07-21 Ray Strode <rstrode@redhat.com>
|
||
|
||
* gimp/data/misc/gimp.desktop.in.in: Add MimeType line to desktop
|
||
file for new MIME system.
|
||
|
||
2004-07-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/gif.c: declared global const variable as static.
|
||
Fixes compiler warnings seen with gcc 3.4.1 (don't ask me why).
|
||
|
||
2004-07-21 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimptemplateeditor.c
|
||
* plug-ins/common/gif.c
|
||
* plug-ins/common/jpeg.c: set GTK_SHADOW_IN on scrolled windows of
|
||
text views. Fixes bug #148025.
|
||
|
||
2004-07-21 Michael Natterer <mitch@gimp.org>
|
||
|
||
Enabled the various "Clear saved foobar now" buttons in prefs:
|
||
|
||
* app/gui/session.[ch]
|
||
* app/menus/menus.[ch]
|
||
* app/widgets/gimpdevices.[ch]: implemented the _clear()
|
||
functions: unlink() the rc file and set an internal flag that it
|
||
has been deleted. Added "gboolean always_save" parameter to the
|
||
_save() functions and don't save anything if it is FALSE and the
|
||
internal deletion flag has been set.
|
||
|
||
* app/gui/gui.c
|
||
* app/widgets/gimpdevicestatus.c: changed accordingly.
|
||
|
||
* app/gui/preferences-dialog.c: added callbacks for all "Save now"
|
||
and "Clear now" buttons and show error messages if clearing fails.
|
||
Inform the user that she has to restart GIMP to see the effect of
|
||
the clearing.
|
||
|
||
2004-07-21 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpmarshal.list
|
||
* app/widgets/gimpcellrendereraccel.[ch]: added "gboolean delete"
|
||
parameter to the GimpCellRendererAccel::accel_edited() signal.
|
||
|
||
* app/widgets/gimpactionview.c: distinguish between deletion of an
|
||
accelerator and the user entering an invalid accelerator.
|
||
|
||
2004-07-21 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/: normalized the identifiers in
|
||
placement.c.
|
||
|
||
2004-07-21 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/context-actions.c: changed names of actions which
|
||
select brushes, patterns etc. from e.g. "context-brush-first" to
|
||
"context-brush-select-first".
|
||
|
||
* menus/image-menu.xml.in: changed accordingly.
|
||
|
||
2004-07-21 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/gui/preferences-dialog.c: remember the keyboard shortcut
|
||
dialog and show it only once.
|
||
|
||
* app/widgets/gimpactionview.c
|
||
* app/widgets/gimpcellrendereraccel.c: minor cleanups.
|
||
|
||
Seems to work pretty well now and thus fixes bug #142922.
|
||
|
||
2004-07-21 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpmarshal.list
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpcellrendereraccel.[ch]: new cell renderer
|
||
which displays an accelerator and allows to edit it (ripped
|
||
out of libegg and modified).
|
||
|
||
* app/widgets/gimpactionview.c: use the new renderer and connect
|
||
to its "accel-edited" signal (its callback is one huge mess that
|
||
needs to be cleaned up). Added ugly hack to work around GTK+ API
|
||
limitation that seems to prevent implementing a shortcut editor in
|
||
a sane way.
|
||
|
||
* app/actions/file-actions.c
|
||
* app/actions/image-actions.c
|
||
* app/actions/tools-actions.c: added ugly hacks here, too.
|
||
|
||
* app/gui/preferences-dialog.c: relaced Cancel/Ok in the shortcut
|
||
editor by Close.
|
||
|
||
2004-07-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* configure.in (ALL_LINGUAS): added back "pa" for Punjabi now that
|
||
the missing po files have been added (tips/pa.po is still missing
|
||
though).
|
||
|
||
2004-07-20 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpactionfactory.[ch]
|
||
* app/widgets/gimpactiongroup.[ch]: added "label" and "stock-id"
|
||
properties to GtkActionGroup and allow to register them in the
|
||
GimpActionFactory.
|
||
|
||
* app/actions/actions.c: register user visible labels and icons
|
||
with all action groups.
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpactionview.[ch]: new widget which shows a
|
||
treeview of action groups and their actions & shortcuts.
|
||
|
||
* app/widgets/gimpaction.[ch]: added gimp_action_name_compare()
|
||
utility function.
|
||
|
||
* app/widgets/gimpwidgets-utils.[ch]: added
|
||
gimp_get_accel_string() utility function.
|
||
|
||
* app/widgets/gimpcontrollers.[ch]: added
|
||
gimp_controllers_get_ui_manager() which will be used for setting
|
||
up the controller mapping dialog.
|
||
|
||
* app/gui/preferences-dialog.c: added a "Configure Keyboard
|
||
Shortcuts" button which pops up a GimpActionView. Work in
|
||
progress...
|
||
|
||
2004-07-20 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/image-actions.c: make sure that the "image-new" and
|
||
"image-new-from-image" actions always have the same shortcut.
|
||
|
||
2004-07-20 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/Lighting/lighting_main.c
|
||
* plug-ins/Lighting/lighting_main.h
|
||
* plug-ins/Lighting/lighting_preview.c
|
||
* plug-ins/Lighting/lighting_preview.h
|
||
* plug-ins/Lighting/lighting_shade.c
|
||
* plug-ins/Lighting/lighting_ui.c: completely reworked UI for
|
||
lighting page. Now supports up to 6 lights (more is trivial).
|
||
Added ability to temporarily isolate selected light. Added
|
||
light intensity controls. Can interactively position each light
|
||
(does not quite work yet for directional lights).
|
||
|
||
2004-07-20 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/tools-actions.c: added an icon to the
|
||
"tools-visibility" action.
|
||
|
||
2004-07-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/composite/gimp-composite.c (gimp_composite_init): now that
|
||
the output depends on --verbose, enable it for stable releases also.
|
||
|
||
2004-07-20 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/presets.c: fixed the incorrect strings
|
||
for input and output of the preset's fields. (a relic of an
|
||
irresponsible search-and-replace script).
|
||
|
||
* plug-ins/gimpressionist/: normalized the identifiers of
|
||
orientmap.c.
|
||
|
||
2004-07-20 Helvetix Victorinox <helvetix@gimp.org>
|
||
|
||
* app/composite/Makefile.am (regenerate): Updated make-installer.py
|
||
command line to take advantage of the new compile time method of
|
||
determining which instruction set to compile.
|
||
|
||
* app/composite/gimp-composite.c (gimp_composite_init): Print the
|
||
list of active instruction sets if the --verbose command line
|
||
switch is ON (via be_verbose)
|
||
|
||
* app/composite/gimp-composite-x86.h: Factored code from the mmx,
|
||
and sse implementations.
|
||
|
||
* app/composite/make-installer.py: Raised the number of test
|
||
iterations from 1 to 10.
|
||
|
||
* app/composite/gimp-composite-3dnow.[ch]
|
||
* app/composite/gimp-composite-3dnow-test.c
|
||
* app/composite/gimp-composite-3dnow-installer.c
|
||
* app/composite/gimp-composite-altivec.[ch]
|
||
* app/composite/gimp-composite-altivec-test.c
|
||
* app/composite/gimp-composite-altivec-installer.c
|
||
* app/composite/gimp-composite-mmx.[ch]
|
||
* app/composite/gimp-composite-altivec-test.c
|
||
* app/composite/gimp-composite-altivec-installer.c
|
||
* app/composite/gimp-composite-sse.[ch]
|
||
* app/composite/gimp-composite-sse-test.c
|
||
* app/composite/gimp-composite-sse-installer.c
|
||
* app/composite/gimp-composite-sse2.[ch]
|
||
* app/composite/gimp-composite-sse2-test.c
|
||
* app/composite/gimp-composite-sse2-installer.c
|
||
* app/composite/gimp-composite-vis.[ch]
|
||
* app/composite/gimp-composite-vis-test.c:
|
||
Regenerated sources via make-installer.py
|
||
|
||
2004-07-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/app_procs.c
|
||
* app/base/base.[ch]
|
||
* app/composite/gimp-composite.[ch]: pass "be_verbose" to the base
|
||
and composite subsystems.
|
||
|
||
2004-07-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* autogen.sh: added some empty lines to improve readability of the
|
||
output in case of problems.
|
||
|
||
* configure.in: bumped version number to 2.1.3.
|
||
|
||
2004-07-19 Helvetix Victorinox <helvetix@gimp.org>
|
||
|
||
* app/composite/gimp-composite-mmx.c
|
||
(xxxgimp_composite_dodge_rgba8_rgba8_rgba8_mmx)
|
||
* app/composite/gimp-composite-mmx.c
|
||
(xxxgimp_composite_divide_rgba8_rgba8_rgba8_mmx)
|
||
* app/composite/gimp-composite-mmx.c
|
||
(gimp_composite_difference_rgba8_rgba8_rgba8_mmx)
|
||
* app/composite/gimp-composite-mmx.c
|
||
(gimp_composite_darken_rgba8_rgba8_rgba8_mmx): More clobber
|
||
register corrections.
|
||
|
||
2004-07-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* Made 2.1.2 release.
|
||
|
||
2004-07-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/winicon/icoload.c
|
||
* plug-ins/winicon/icosave.c: added explicit casts to please the
|
||
compiler.
|
||
|
||
2004-07-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gimpressionist/Makefile.am (gimpressionist_sources):
|
||
added paper.h.
|
||
|
||
* plug-ins/MapObject/Makefile.am (MapObject_SOURCES): added back
|
||
arcball.h.
|
||
|
||
* plug-ins/MapObject/mapobject_main.c
|
||
* plug-ins/MapObject/mapobject_preview.c: no need to include
|
||
arcball.h here.
|
||
|
||
* plug-ins/gfig/Makefile.am (SUBDIRS): added back gfig-examples
|
||
|
||
* plug-ins/gfig/gfig-examples/Makefile.am: cleanup.
|
||
|
||
2004-07-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/Lighting/lighting_ui.c: fixed some GUI issues:
|
||
left-align labels, use stock buttons, added line-breaks to make
|
||
the code fit into 80 columns.
|
||
|
||
2004-07-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/Lighting/lighting_ui.c: fixed a couple of issues with
|
||
the new code: don't include individual glib headers, never ever
|
||
use sprintf(), mark user-visible strings for translations, use
|
||
default messages, removed trailing whitespace.
|
||
|
||
2004-07-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/Lighting/lighting_ui.c: added ability to save and load
|
||
presets for lights.
|
||
|
||
2004-07-19 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/orientation.c: normalized some variables
|
||
in the module and fixed some indentation.
|
||
|
||
2004-07-19 Helvetix Victorinox <helvetix@gimp.org>
|
||
|
||
* app/composite/gimp-composite-mmx.c
|
||
(gimp_composite_addition_rgba8_rgba8_rgba8_mmx)
|
||
* app/composite/gimp-composite-mmx.c
|
||
(gimp_composite_burn_rgba8_rgba8_rgba8_mmx)
|
||
* app/composite/gimp-composite-x86.h: Correction of clobbered
|
||
register lists, as additional progress against bug #147013.
|
||
|
||
2004-07-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpmarshal.list: removed unused VOID:UINT,STRING.
|
||
|
||
2004-07-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/gui/file-open-location-dialog.c
|
||
(file_open_location_dialog_show): added the "web" icon left of
|
||
label & entry.
|
||
|
||
2004-07-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint/gimppaintcore.h: removed enum GimpPaintCoreState.
|
||
|
||
* app/paint/paint-enums.h: added enum GimpPaintState (with values
|
||
that have a name space).
|
||
|
||
* app/paint/gimppaintcore.[ch]
|
||
* app/paint/gimpairbrush.c
|
||
* app/paint/gimpbrushcore.c
|
||
* app/paint/gimpclone.c
|
||
* app/paint/gimpconvolve.c
|
||
* app/paint/gimpdodgeburn.c
|
||
* app/paint/gimperaser.c
|
||
* app/paint/gimpink.c
|
||
* app/paint/gimppaintbrush.c
|
||
* app/paint/gimppaintcore-stroke.c
|
||
* app/paint/gimpsmudge.c
|
||
* app/tools/gimppainttool.c: changed accordingly.
|
||
|
||
* app/tools/gimpinktool.c: removed unused #include.
|
||
|
||
2004-07-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpchannel-combine.c (gimp_channel_combine_ellipse):
|
||
moved variable declarations to the scope they are being used in,
|
||
removed trailing whitespace, minor cleanups.
|
||
|
||
2004-07-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/core/gimpchannel-combine.c: put in two lines accidentally
|
||
omitted in previous change, improve doc comment.
|
||
|
||
2004-07-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpbase/gimpwin32-io.h: added copyright header, added
|
||
#defines for access(), F_OK, R_OK and X_OK.
|
||
|
||
* app/core/gimpdata.c: include the above instead of defining
|
||
the workarounds here.
|
||
|
||
* app/base/tile-swap.c
|
||
* app/config/gimpconfig-dump.c
|
||
* libgimpthumb/gimpthumb-utils.c
|
||
* libgimpthumb/gimpthumbnail.c: for consistency, #include
|
||
gimpwin32-io.h with "" instead of <>.
|
||
|
||
2004-07-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpchannel-combine.c (gimp_channel_combine_ellipse):
|
||
comments not intended for gtk-doc must not start with '/**'.
|
||
|
||
2004-07-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/plug-in/plug-in.h (struct _PlugIn): removed obsolete
|
||
compile-time check for GLIB >= 2.3.5.
|
||
|
||
2004-07-19 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* ChangeLog: Fixed a copy-and-paste error with the dates of my commits.
|
||
* plug-ins/gimpressionist/ppmtool.c: removed a few commented-out
|
||
asserts, and the function that was used to implement them.
|
||
|
||
2004-07-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/widgets-types.h: reordered and commented to match
|
||
API docs.
|
||
|
||
2004-07-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/imagemap/imap_browse.[ch]: renamed struct member
|
||
file_selection to file_chooser.
|
||
|
||
2004-07-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/config/config-types.h: removed GimpConfigInterface typedef,
|
||
added comments to typedefs which don't belong here.
|
||
|
||
* app/config/gimpconfig.h: added GimpConfigInterface typedef.
|
||
|
||
* app/core/core-types.h
|
||
* app/display/display-types.h: added commented out typedefs for
|
||
types that live in config-types.h for obscure reasons.
|
||
|
||
* app/core/core-types.h: reordered stuff to match the order in the
|
||
API docs (makes keeping stuff in sync much easier).
|
||
|
||
2004-07-19 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/repaint.c: replaced a few if's+destructors
|
||
pairs for ppm_ with just the destructors.
|
||
|
||
2004-07-19 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/repaint.c: normalized some identifiers of
|
||
repaint.c, and corrected some indentation there.
|
||
|
||
2004-07-18 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/core/gimpchannel-combine.c: improve anti-aliasing for
|
||
elliptical selections, as described in bug #147836.
|
||
|
||
2004-07-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/composite/gimp-composite-mmx.h: don't start a comment with
|
||
/** unless it's meant to be parsed by gtk-doc.
|
||
|
||
* app/actions/Makefile.am:
|
||
* app/actions/file-dialog-commands.[ch]: removed, not used any
|
||
longer.
|
||
|
||
2004-07-18 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/paint/gimpink-blob.c (blob_make_convex): Check if the
|
||
array index is legal before using it, not the other way around.
|
||
Fixes bug #144856.
|
||
|
||
2004-07-17 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* plug-ins/common/polar.c (dialog_update_preview): Fixed a
|
||
write to unallocated memory that was causing crashes in various
|
||
spots.
|
||
|
||
2004-07-17 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* plug-ins/common/polar.c (polarize_func): moved array
|
||
initialization out of variable declaration. Fixes bug #147799.
|
||
|
||
2004-07-17 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimphelp-ids.h: added the removed help IDs back.
|
||
|
||
* app/widgets/gimpfileprocview.[ch]: cache all file_procs' help
|
||
IDs and added gimp_file_proc_view_get_help_id() which returns the
|
||
selected item's help ID.
|
||
|
||
* app/widgets/gimpfiledialog.c: added a custom help func which
|
||
shows the help for the selected file_proc if the proc_view has the
|
||
focus.
|
||
|
||
2004-07-17 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/file-actions.c (file_actions): use GIMP_STOCK_WEB
|
||
for "file-open-location".
|
||
|
||
* app/widgets/gimpfiledialog.c: create the scrolled window with
|
||
shadow_type GTK_SHADOW_IN.
|
||
|
||
* app/widgets/gimpfileprocview.c (gimp_file_proc_view_new): skip
|
||
procedures that register a prefix (the URL loader).
|
||
|
||
* app/widgets/gimphelp-ids.h: removed help IDs that used to be
|
||
used from the file-open and file-save menus.
|
||
|
||
* plug-ins/common/xwd.c (query): "X window dump" seems to be more
|
||
appropriate than "X window image".
|
||
|
||
2004-07-17 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/Makefile.am
|
||
* app/actions/file-dialog-actions.[ch]
|
||
* app/actions/file-open-actions.[ch]
|
||
* app/actions/file-save-actions.[ch]: these aren't needed any
|
||
longer.
|
||
|
||
* app/actions/actions.c: changed accordingly.
|
||
|
||
* app/menus/Makefile.am
|
||
* app/menus/file-dialog-menu.[ch]
|
||
* app/menus/file-open-menu.[ch]
|
||
* app/menus/file-save-menu.[ch]: these aren't needed any longer.
|
||
|
||
* app/menus/menus.c: changed accordingly.
|
||
|
||
* menus/Makefile.am
|
||
* menus/file-open-menu.xml
|
||
* menus/file-save-menu.xml: these are also not needed any longer.
|
||
|
||
2004-07-17 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* plug-ins/bmp/bmpwrite.c (WriteImage): Applied a patch from
|
||
Brion Vibber that fixes corruption when saving RLE-encoded
|
||
BMPs on big endian hosts. Fixes bug #147759.
|
||
|
||
2004-07-17 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/: normalized the identifiers of
|
||
general.c and general.h. Also, renamed a callback from _store
|
||
to simply _callback to avoid confusion with the _store methods.
|
||
Some of the member variables of the pcvals struct were changed
|
||
as a result.
|
||
|
||
2004-07-16 Helvetix Victorinox <helvetix@gimp.org>
|
||
|
||
* app/composite/gimp-composite-mmx.[ch]
|
||
* app/composite/gimp-composite-sse.[ch]
|
||
* app/composite/gimp-composite-sse2.[ch]:
|
||
|
||
We've had trouble compiling with the Intel compiler which
|
||
identifies itself as GCC, but doesn't support the same extended
|
||
assembly features/misfeatures as GCC. With the help of the Intel
|
||
compiler group, we've determined that the Intel compiler can be
|
||
identified at compile time by the definition of the preprocessor
|
||
variable __INTEL_COMPILER.
|
||
|
||
These changes make all of the assembly code currently written to
|
||
simply avoid the Intel compiler.
|
||
|
||
This is an interim solution to get a build working despite the
|
||
Intel compiler. A more correct solution has been identified, see
|
||
the discussion of bug #147013 for more information.
|
||
|
||
2004-07-17 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/xcf/xcf.c (xcf_init): also register the internal XCF
|
||
handlers according to the new scheme.
|
||
|
||
* plug-ins/common/Makefile.am
|
||
* plug-ins/common/plugin-defs.pl
|
||
* plug-ins/common/hrz.c: removed the HRZ file plug-in since it
|
||
doesn't seem to be very useful.
|
||
|
||
2004-07-17 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/plug-in/plug-ins.c (plug_ins_temp_proc_def_add)
|
||
(plug_ins_init_file): use g_slist_prepend() instead of
|
||
g_slist_append().
|
||
|
||
* plug-ins/common/url.c (query): ported to the new PDB registration
|
||
scheme.
|
||
|
||
2004-07-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/plug-in/plug-ins.c (plug_ins_init): sort the file procedures
|
||
by their menu labels.
|
||
|
||
* app/widgets/gimpfileprocview.c: removed the sort function here.
|
||
|
||
2004-07-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpfileprocview.[ch]: added new widget that offers
|
||
a treeview on file procedures.
|
||
|
||
* app/widgets/gimpfiledialog.[ch]: replaced the file type option
|
||
menu with the new GimpFileProcView widget.
|
||
(gimp_file_dialog_set_image): reset the file type to Automatic
|
||
(fixes bug #141535).
|
||
|
||
* app/actions/file-commands.c
|
||
* app/gui/file-open-dialog.[ch]
|
||
* app/gui/file-save-dialog.[ch]: changed accordingly.
|
||
|
||
* plug-ins/common/bz2.c
|
||
* plug-ins/common/gz.c: don't register "xcf.gz" and "xcf.bz2"
|
||
extension. It's redundant and breaks the code that sets the
|
||
extension from the selected file-type.
|
||
|
||
* plug-ins/common/dicom.c: register a shorter menu label.
|
||
|
||
* plug-ins/common/gbr.c
|
||
* plug-ins/common/gih.c
|
||
* plug-ins/common/pat.c
|
||
* plug-ins/common/url.c: register stock icons.
|
||
|
||
2004-07-16 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/Lighting/lighting_main.[ch]
|
||
* plug-ins/Lighting/lighting_preview.[ch]
|
||
* plug-ins/Lighting/lighting_shade.c
|
||
* plug-ins/Lighting/lighting_ui.c: Made this plug-in support
|
||
multiple light sources; implemented three, architecture now
|
||
supports any number. Changed material properties to more intuitve
|
||
names; added "metallic" property. Cleaned out some unused,
|
||
commented-out code.
|
||
|
||
2004-07-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb.pl: include "libgimpbase/gimpbase.h" instead of
|
||
"libgimpbase/gimpparasite.h" for getting the GimpParasite type.
|
||
|
||
* tools/pdbgen/app.pl
|
||
* tools/pdbgen/pdb/drawable.pdb
|
||
* tools/pdbgen/pdb/edit.pdb
|
||
* tools/pdbgen/pdb/gradients.pdb
|
||
* tools/pdbgen/pdb/guides.pdb
|
||
* tools/pdbgen/pdb/image.pdb: removed redundant #includes.
|
||
|
||
* tools/pdbgen/pdb/plug_in.pdb: standardized "success" logic.
|
||
Consistently fail if there is no currently queried plugin.
|
||
|
||
* app/pdb/*.c: regenerated.
|
||
|
||
2004-07-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-transform.c: made gtk-doc even
|
||
happier; clarified meaning of the "use_offsets" parameter.
|
||
|
||
2004-07-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpdata.c:
|
||
* app/display/gimpcanvas.c:
|
||
* app/display/gimpdisplayshell.c
|
||
* app/display/gimpdisplayshell-transform.c: corrected API
|
||
documentation, removed trailing whitespace.
|
||
|
||
Please do always build the documentation if you add or change any
|
||
gtk-doc comments.
|
||
|
||
2004-07-15 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/display/gimpcanvas.c:
|
||
* app/display/gimpdisplayshell-transform.c: added gtk-doc
|
||
comments for all public functions that lack them.
|
||
|
||
* app/display/gimpdisplayshell.c: added a couple of
|
||
gtk-doc comments.
|
||
|
||
2004-07-15 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/core/gimpdata.c: added gtk-doc comments for
|
||
public functions.
|
||
|
||
2004-07-15 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/: normalized the identifiers of
|
||
paper.c and paper.h. Made one variable local to the function
|
||
instead of module static.
|
||
|
||
2004-07-15 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/: normalized the ppmtools.c and
|
||
ppmtool.h identifiers. Also fixed some (but not all) of the
|
||
syntax.
|
||
|
||
2004-07-15 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* plug-ins/winicon/icoload.c:
|
||
* plug-ins/winicon/icosave.c: Applied a patch from Brion Vibber
|
||
that fixes byte-swapping on big endian hosts. Fixes bug #147610.
|
||
|
||
2004-07-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/helpbrowser/dialog.c
|
||
* plug-ins/helpbrowser/uri.c: don't warn if no help pages are
|
||
installed and the Home button is clicked.
|
||
|
||
2004-07-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/file/file-open.c (file_open_layer): don't crash if no
|
||
layer or only one layer is visible. Fixes bug #143804.
|
||
|
||
* app/app_procs.c (app_run): fixed log domain registration.
|
||
|
||
2004-07-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpviewable.[ch]: corrected API docs and fixed
|
||
function parameter names to silent gtk-doc warnings.
|
||
|
||
2004-07-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/app_procs.c (app_run): register a log handler for the
|
||
"Gimp-Menus" domain.
|
||
|
||
2004-07-15 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* plug-ins/common/mng.c: cleanup.
|
||
|
||
2004-07-15 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/core/gimpviewable.c: added gtk-doc comments for public
|
||
functions.
|
||
|
||
2004-07-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/file-commands.h: reordered to match the .c file.
|
||
|
||
* app/core/gimpitem.c
|
||
* app/vectors/gimpvectors-import.c: fixed API docs.
|
||
|
||
2004-07-14 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* plug-ins/common/png.c:
|
||
* plug-ins/common/mng.c: Fixed erroneously reported warning
|
||
message when saving indexed layers with an alpha channel but
|
||
no transparent pixels.
|
||
|
||
2004-07-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/app_procs.c (app_run): register a log handler for the
|
||
"Gimp-Actions" domain.
|
||
|
||
2004-07-14 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* devel-docs/objects.txt: . . . and removed because it is
|
||
redundant with devel-docs/app/app.hierarchy.
|
||
|
||
2004-07-14 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* devel-docs/objects.txt: added file containing a map of Gimp's
|
||
GObject hierarchy .
|
||
|
||
2004-07-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpstatusbar.[ch]: massively changed: removed
|
||
message_ids, the message mem chunk and all signals. Added new
|
||
function gimp_statusbar_replace() which updates a message without
|
||
moving it to the top of the stack. Fixes bug #120175.
|
||
|
||
* app/display/gimpdisplayshell-title.[ch]: renamed
|
||
gimp_display_shell_update_title() to
|
||
gimp_display_shell_title_update() and switched from pop()/push()
|
||
to replace() so the title message keeps its place in the stack.
|
||
Added new function gimp_display_shell_title_init() which push()es
|
||
the title message to the stack.
|
||
|
||
* app/display/gimpdisplayshell.c (gimp_display_shell_new): call
|
||
gimp_display_shell_title_init() so the "title" message is at the
|
||
bottom of the stack.
|
||
|
||
* app/display/gimpdisplayshell-callbacks.c
|
||
* app/display/gimpdisplayshell-handlers.c: changed accordingly.
|
||
|
||
2004-07-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-console.[ch]
|
||
* plug-ins/script-fu/script-fu.c
|
||
* plug-ins/script-fu/siod-wrapper.[ch]
|
||
* plug-ins/script-fu/siod/slib.c: applied a patch from Kevin
|
||
Cozens that removes an unneeded pipe which was causing problems
|
||
on long output from the SIOD interpreter (bug #139200). Also
|
||
shortened the welcome message.
|
||
|
||
2004-07-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/pagecurl/pagecurl.c: GUI polishing.
|
||
|
||
2004-07-14 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/: Added more underscores to identifiers.
|
||
Fixed some of the style issues (added whitespace before the '(' in
|
||
function calls).
|
||
|
||
2004-07-14 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* plug-ins/common/mng.c: Now writes a global palette chunk, and
|
||
empty palette chunks for the frames that use it. This saves a
|
||
bit of diskspace.
|
||
|
||
2004-07-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpimage.c: added properties "gimp", "id", "width",
|
||
"height" and "base-type". Moved all code from gimp_image_new()
|
||
to GObject::constructor().
|
||
|
||
* app/core/gimpimage-convert.c
|
||
* app/core/gimpimage-crop.c
|
||
* app/core/gimpimage-resize.c
|
||
* app/core/gimpimage-rotate.c
|
||
* app/core/gimpimage-scale.c
|
||
* app/core/gimpimage-undo-push.c: set "width", "height" and
|
||
"base-type" with g_object_set() so "notify" is emitted on the
|
||
properties.
|
||
|
||
* app/core/gimpimage-undo.c (gimp_image_undo_pop_stack):
|
||
freeze/thaw property notifications around undoing/redoing so they
|
||
are not emitted in the middle of the undo operation.
|
||
|
||
2004-07-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpitem.c: converted tabs to spaces, cleanup,
|
||
reviewed new API docs.
|
||
|
||
2004-07-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/tiff.c: applied a patch done by Brion Vibber
|
||
and Philip Lafleur that fixes loading of CMYK TIFF images on
|
||
big-endian hardware (bug #147328).
|
||
|
||
2004-07-14 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* plug-ins/common/mng.c (respin_cmap): Properly check the return
|
||
value of find_unused_ia_color(). The plugin will now save indexed
|
||
MNGs correctly; fixes bug #139947. Also converted tabs to spaces.
|
||
|
||
2004-07-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
Code review & cleanup:
|
||
|
||
* app/config/gimpguiconfig.[ch]: removed transparency-size,
|
||
transparency-type and snap-distance properties...
|
||
|
||
* app/config/gimpdisplayconfig.[ch]: ...and added them here.
|
||
|
||
* app/display/gimpdisplayshell.c
|
||
* app/tools/gimpmovetool.c: changed accordingly.
|
||
|
||
* app/core/gimpimage-scale.[ch] (gimp_layer_scale_check): added a
|
||
"max_memsize" parameter instead of looking it up in GimpGuiConfig.
|
||
|
||
* app/actions/image-commands.c: changed accordingly.
|
||
|
||
* app/core/gimparea.c
|
||
* app/core/gimpdrawable.c: converted tabs to spaces, cleanup.
|
||
|
||
* app/core/gimpprojection.[ch]: renamed IdleRenderStruct to
|
||
GimpProjectionIdleRender, reordered functions, cleanup.
|
||
|
||
* app/display/gimpdisplay-handlers.c
|
||
* app/display/gimpdisplay.c: removed unused #includes.
|
||
|
||
* app/display/gimpdisplayshell.[ch]
|
||
* app/display/gimpdisplayshell-close.c: renamed
|
||
shell->warning_dialog to shell->close_dialog, some random
|
||
cleanups.
|
||
|
||
* app/display/gimpdisplayshell-handlers.c
|
||
* app/widgets/gimpselectioneditor.c: minor coding style cleanup.
|
||
|
||
2004-07-13 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/core/gimpitem.c: added documentation comments to some
|
||
of the functions.
|
||
|
||
2004-07-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/Makefile.am
|
||
* app/display/gimpdisplayshell-close.[ch]: new files for
|
||
gimp_display_shell_close() and its dialog & callback.
|
||
|
||
* app/display/gimpdisplayshell.[ch]: removed from here.
|
||
|
||
* app/actions/view-actions.c (view_close_view_cmd_callback):
|
||
changed accordingly.
|
||
|
||
2004-07-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/pagecurl/pagecurl.c: code cleanup. Use enums instead of
|
||
a plethora of booleans. Added some macros for readability. Allow
|
||
to use a reversed gradient for colorizing the curl.
|
||
|
||
2004-07-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/Makefile.am
|
||
* app/core/core-types.h
|
||
* app/core/gimppickable.[ch]: new interface which has
|
||
get_image_type(), get_tiles() and get_color_at() methods.
|
||
|
||
* app/core/gimpdrawable.[ch]
|
||
* app/core/gimpimagemap.[ch]
|
||
* app/core/gimpprojection.[ch]: implement GimpPickableInterface
|
||
and removed public get_colot_at() functions.
|
||
|
||
* app/core/gimpimage-pick-color.[ch]: removed typedef
|
||
GimpImagePickColorFunc and gimp_image_pick_color_by_func(). Use
|
||
gimp_pickable_pick_color() instead.
|
||
|
||
* app/core/gimpimage-contiguous-region.c
|
||
* app/core/gimpimage-crop.c
|
||
* app/gui/info-window.c
|
||
* app/paint/gimpconvolve.c
|
||
* app/paint/gimpsmudge.c
|
||
* app/tools/gimpbycolorselecttool.c
|
||
* app/tools/gimpimagemaptool.c
|
||
* app/widgets/gimpselectioneditor.c: use GimpPickable functions
|
||
instead of the various get_color_at() functions. Simplifies code
|
||
which has a "sample_merged" boolean. Various cleanups.
|
||
|
||
2004-07-13 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/presets.c: Added underscores between
|
||
words in function names according to the GIMP's (and common
|
||
sense) convention.
|
||
|
||
2004-07-13 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/: Moved the global declarations of
|
||
img_has_alpha and create_colorpage to more specialized headers.
|
||
|
||
2004-07-13 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/: Added the paper.h header for the functions
|
||
defined in the paper.c module. (thus removing more declarations
|
||
from gimpressionist.h)
|
||
|
||
2004-07-13 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-preview.[ch}
|
||
* plug-ins/gfig/gfig.h: Made Cancel work properly. Moved "show grid",
|
||
"snap to grid", and "show image" checkbuttons back onto main
|
||
interface. Eliminated GtkPreview and removed undef of
|
||
GTK_DISABLE_DEPRECATED from gfig-preview.c. Removed some
|
||
unused code.
|
||
|
||
2004-07-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gflare/gflare.c (preview_handle_idle): use
|
||
gtk_widget_queue_draw_area() instead of the deprecated
|
||
gtk_widget_draw() routine.
|
||
|
||
* plug-ins/gimpressionist/orientmap.c
|
||
* plug-ins/gimpressionist/paper.c
|
||
* plug-ins/gimpressionist/sizemap.c: use gtk_widget_queue_draw()
|
||
instead of the deprecated gtk_widget_draw() routine.
|
||
|
||
2004-07-13 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/preview.c
|
||
* plug-ins/gimpressionist/sizemap.c:
|
||
eliminated two compile-time warnings.
|
||
|
||
2004-07-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
Added a GimpProjection object which maintains the idle projection
|
||
logic that was in GimpDisplay and takes care of constructing the
|
||
projection even without any display open. Makes color picking and
|
||
other reads from the projection work without display and fixes the
|
||
major bug that we were constructing the projection n times (!)
|
||
for n displays.
|
||
|
||
* app/core/Makefile.am
|
||
* app/core/gimpimage-projection.[ch]: removed.
|
||
|
||
* app/core/core-types.h
|
||
* app/core/gimpmarshal.list
|
||
* app/core/gimparea.[ch]
|
||
* app/core/gimpprojection.[ch]
|
||
* app/core/gimpprojection-construct.[ch]: new files assembled from
|
||
the pieces of gimpdisplay.c and gimpimage-projection.c.
|
||
|
||
* app/core/gimpimage.[ch]: create a GimpProjection.
|
||
Removed explicit projection realloc calls because the projection
|
||
connects to the relevant GimpImage signals now.
|
||
Added gimp_image_coords_in_active_drawable().
|
||
|
||
* app/display/Makefile.am
|
||
* app/display/gimpdisplay-area.[ch]: removed.
|
||
|
||
* app/display/gimpdisplay.[ch]: stripped away the idle render stuff
|
||
and just keep a list of update_areas which is painted on flush().
|
||
Removed gimp_display_coords_in_active_drawable().
|
||
|
||
* app/display/gimpdisplay-foreach.[ch]: removed
|
||
gimp_display_finish_draw().
|
||
|
||
* app/core/gimpchannel.c
|
||
* app/core/gimpimage-contiguous-region.c
|
||
* app/core/gimpimage-convert.c
|
||
* app/core/gimpimage-crop.c
|
||
* app/core/gimpimage-merge.c
|
||
* app/core/gimpimage-pick-color.c
|
||
* app/core/gimpimage-scale.c
|
||
* app/core/gimppalette-import.c
|
||
* app/display/gimpdisplay-handlers.c
|
||
* app/display/gimpdisplayshell-render.c
|
||
* app/display/gimpdisplayshell.c
|
||
* app/gui/info-window.c
|
||
* app/tools/gimpbucketfilltool.c
|
||
* app/tools/gimpbycolorselecttool.c
|
||
* app/tools/gimpclonetool.c
|
||
* app/tools/gimpcolortool.c
|
||
* app/tools/gimpeditselectiontool.c
|
||
* app/tools/gimpfliptool.c
|
||
* app/tools/gimpimagemaptool.c
|
||
* app/tools/gimpiscissorstool.c
|
||
* app/tools/gimppainttool.c
|
||
* app/tools/gimpselectiontool.c
|
||
* app/tools/gimptransformtool.c
|
||
* app/widgets/gimpselectioneditor.c: changed accordingly.
|
||
|
||
2004-07-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppixmap.[ch]: declared GimpPixmap as deprecated.
|
||
|
||
* libgimpwidgets/gimpwidgets.[ch]: ditto for gimp_pixmap_button_new().
|
||
|
||
* plug-ins/Lighting/ChangeLog: removed outdated and unused ChangeLog.
|
||
|
||
* plug-ins/Lighting/Makefile.am
|
||
* plug-ins/Lighting/*.xpm: removed XPM files...
|
||
|
||
* configure.in
|
||
* plug-ins/Lighting/images: ... and added them as PNG images here.
|
||
These should be redone with antialiased edges.
|
||
|
||
* plug-ins/Lighting/lighting_stock.[ch]
|
||
* plug-ins/Lighting/lighting_ui.c: register stock icons and use
|
||
those instead of GimpPixmaps.
|
||
|
||
* plug-ins/MapObject/Makefile.am
|
||
* plug-ins/MapObject/*.xpm: removed duplicated XPM files.
|
||
|
||
* plug-ins/MapObject/mapobject_stock.[ch]: register stock icons
|
||
reusing the generated header from the Lighting plug-in.
|
||
|
||
* plug-ins/MapObject/mapobject_ui.c: use them.
|
||
|
||
* plug-ins/pagecurl/pagecurl.c: undef GIMP_DISABLE_DEPRECATED until
|
||
GimpPixmap has been replaced here as well.
|
||
|
||
2004-07-13 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/presets.c: fixed bug #147483 (gimpressionist
|
||
will delete global presets if the user running GIMP has priviliges to
|
||
do so). This was done by creating a function to check if a preset is
|
||
global, and by making sure the delete button is in-sensitive when
|
||
this is the case.
|
||
|
||
2004-07-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcolorbutton.c
|
||
* libgimpwidgets/gimpcolornotebook.c
|
||
* libgimpwidgets/gimpcolorscale.c
|
||
* libgimpwidgets/gimpcolorscales.c
|
||
* libgimpwidgets/gimpcolorselect.c
|
||
* libgimpwidgets/gimpcolorselection.c
|
||
* libgimpwidgets/gimpframe.c
|
||
* libgimpwidgets/gimppickbutton.c
|
||
* libgimpwidgets/gimpunitmenu.c: some code review and cosmetics.
|
||
|
||
2004-07-13 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/*.[ch]: normalized some of brush.c's
|
||
identifiers (= variable names and function name)
|
||
|
||
2004-07-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimp-utils.c (gimp_g_value_get_memsize): handle NULL
|
||
string values.
|
||
|
||
2004-07-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/jpeg.c: override the output_message error
|
||
handler in order to propagate warnings to the user interface
|
||
(related to bug #145212).
|
||
|
||
2004-07-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimp-utils.[ch]: added new function
|
||
gimp_g_value_get_memsize() that attempts to calculate the memory
|
||
requirements for a GValue.
|
||
|
||
* app/text/gimptextundo.c (gimp_text_undo_get_memsize): use the
|
||
new function to obtain a better estimate for the size of the text
|
||
undo.
|
||
|
||
2004-07-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimptexttool.c (gimp_text_tool_create_layer): plugged
|
||
a tiny memory leak.
|
||
|
||
2004-07-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpimage-undo.c: resurrected some bit-rotting debug
|
||
code. Might become useful one day.
|
||
|
||
2004-07-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* autogen.sh: when automake 1.8 is being used, require at least
|
||
version 1.8.3. Earlier versions of the automake-1.8 series don't
|
||
handle gimp-console correctly.
|
||
|
||
2004-07-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/config/gimpconfig-dump.c
|
||
* app/display/gimpdisplayshell-title.c
|
||
(gimp_display_shell_format_title): applied patch from Dave Neary
|
||
which adds %B which expands to (modified) if the image is
|
||
dirty. Also added %A which expands to (clean) because we also have
|
||
a short indicator for the clean image. Fixes bug #130943.
|
||
|
||
2004-07-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/Makefile.am: removed hack for gimp-console compilation.
|
||
automake seems to handle it correctly all by itself.
|
||
|
||
2004-07-12 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* app/app_procs.c: added
|
||
#ifdef G_OS_WIN32
|
||
#include <windows.h>
|
||
#endif
|
||
|
||
2004-07-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpbufferview.[ch]: added a preview of the global
|
||
buffer.
|
||
|
||
2004-07-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/Makefile.am: make sure that gimp-console is enabled for
|
||
'make dist'. Use it to dump the system gimprc and gimprc man-page.
|
||
|
||
2004-07-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/text/gimptextundo.[ch]: removed member "guint time"...
|
||
|
||
* app/core/gimpundo.[ch]: ...and added it here.
|
||
|
||
* app/tools/gimptexttool.c (gimp_text_tool_apply): changed
|
||
accordingly. Reordered undo compression code to look like other
|
||
pieces of code which do undo compression.
|
||
|
||
2004-07-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpundo.[ch]
|
||
* app/core/gimpitemundo.[ch]
|
||
* app/text/gimptextundo.[ch]: removed all _new() functions and
|
||
added properties and GObject::constructor() implementations
|
||
instead.
|
||
|
||
* app/core/gimpimage-undo.[ch] (gimp_image_undo_push): added
|
||
"GType undo_gtype" parameter and allow to pass name-value pairs as
|
||
"...". Use the new GParameter utility functions to construct the
|
||
appropriate undo step with g_object_newv().
|
||
|
||
(gimp_image_undo_push_item): removed.
|
||
|
||
(gimp_image_undo_push_undo): removed. Merged its code back into
|
||
gimp_image_undo_push(), where it originally came from.
|
||
|
||
* app/core/gimpimage-undo-push.c
|
||
* app/core/gimpundostack.c
|
||
* app/paint/gimppaintcore-undo.c
|
||
* app/tools/gimptransformtool-undo.c
|
||
* app/widgets/gimpundoeditor.c: changed accordingly.
|
||
|
||
2004-07-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-preview.c
|
||
* plug-ins/gfig/gfig-style.c
|
||
* plug-ins/gfig/gfig.c: some include cleanups. Use
|
||
libgimpbase/gimpwin32-io.h instead of defining W_OK explicitely.
|
||
Don't undef GTK_DISABLE_DEPRECATED except for gfig-preview.c.
|
||
|
||
2004-07-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/round-corners.scm: applied patch from
|
||
Dave Neary that changes the behavior from undo disable/enable to
|
||
using an undo group if the script doesn't work on a copy of the
|
||
image. Fixes bug #146344.
|
||
|
||
2004-07-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* menus/toolbox-menu.xml.in: applied patch from Brion Vibber
|
||
which adds <Toolbox>/Acquire/Paste as new. Fixes bug #147358.
|
||
|
||
2004-07-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimp-modules.c: don't do anything if gimp->no_interface
|
||
is TRUE.
|
||
|
||
2004-07-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
Made the gimp-console binary compile.
|
||
Finishes core/GUI separation and fixes bug #71514:
|
||
|
||
* configure.in: removed the crazy-hacker warning for
|
||
--enable-gimp-console.
|
||
|
||
* app/Makefile.am: for gimp-console, copy app_procs.c to
|
||
app_procs_console.c and compile it instead of app_procs.c with
|
||
-DGIMP_CONSOLE_COMPILATION
|
||
|
||
* app/app_procs.[ch]: added some #ifndef GIMP_CONSOLE_COMPILATION
|
||
to skip GUI stuff for the gimp-console case.
|
||
Renamed app_gui_libs_init() to app_libs_init(), renamed
|
||
app_gui_abort() to app_abort() and added app_exit() so everything
|
||
that needs #ifdefs lives here now.
|
||
|
||
* app/main.c: changed accordingly.
|
||
|
||
* app/gui/gui.c (gui_abort): really abort (call exit()).
|
||
|
||
2004-07-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* INSTALL: made the suggestion to use binary packages more
|
||
prominent, mention --enable-gimp-console.
|
||
|
||
2004-07-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/sanity.[ch]: removed the gtk+ sanity check here ...
|
||
|
||
* app/gui/gui.c: ... and do it here from gui_libs_init().
|
||
|
||
* app/main.c: changed accordingly.
|
||
|
||
2004-07-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/app_procs.s: don't use gtk_main() / gtk_main_quit() but run
|
||
our own main-loop like we already used to do when being run
|
||
non-interactively.
|
||
|
||
2004-07-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpdialogfactory.c
|
||
(gimp_dialog_factories_set_busy_foreach)
|
||
(gimp_dialog_factories_unset_busy_foreach): set/unset the busy
|
||
cursor on all windows which have widget->window, not only for
|
||
those which are GTK_WIDGET_VISIBLE. Fixes stale busy cursors when
|
||
dialogs are hidden while the busy cursor is active and later shown
|
||
again.
|
||
|
||
2004-07-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplay.c: added an "id" CONSTRUCT_ONLY
|
||
property. Some minor cleanup.
|
||
|
||
2004-07-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/Makefile.am
|
||
* app/core/gimp-gui.[ch]: new files defining a GimpGui vtable
|
||
struct and contianing all the vtable wrapper functions. Reordered
|
||
and renamed some functions for consistency.
|
||
|
||
* app/core/gimp.[ch]: removed all the vtable code.
|
||
|
||
* app/gui/gui-vtable.c: changed accordingly.
|
||
|
||
2004-07-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/display/gimpdisplay-foreach.c
|
||
(gimp_displays_get_dirty_images): remove images from the
|
||
container when they become clean. Should move to the Gimp object.
|
||
|
||
* app/gui/quit-dialog.c: some cosmetic changes.
|
||
|
||
2004-07-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/tiff.c: applied a patch from Brion Vibber that
|
||
sets the 'Save color values from transparent pixels' insensitive
|
||
when there's no alpha channel.
|
||
|
||
2004-07-11 Hans Breuer <hans@breuer.org>
|
||
|
||
* **/makefile.msc : updated
|
||
app/actions/makefile.msc app/menus/makefile.msc : (new files)
|
||
app/actions/Makefile.msc app/menus/Makefile.am : added to EXTRA_DIST
|
||
|
||
* libgimpbase/gimputils.c libgimpwidgets/gimpmemsizeentry.c
|
||
app/widgets/gimppropwidgets.c : bumped compiler version check,
|
||
msvc6 still can't cast from unsigned __int64 to double
|
||
|
||
* app/actions/debug-actions.c : only use debug_*_callback
|
||
and thus debug_action if ENABLE_DEBUG_MENU
|
||
|
||
* app/core/gimpalette-import.c : added gimpwin32-io.h
|
||
|
||
* plug-ins/common/convmatrix.c : s/snprintf/g_snprintf/
|
||
|
||
* plug-ins/common/screenshot.c : make it compile with msvc,
|
||
but still no win32 specific implementation ...
|
||
|
||
2004-07-11 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/gfig/gfig-dobject.h: fix commit error that
|
||
broke build.
|
||
|
||
2004-07-11 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c
|
||
* plug-ins/gfig/gfig-dobject.[ch]
|
||
* plug-ins/gfig/gfig.c: added buttons to select an object, and
|
||
raise or lower the selected object; also a few minor cleanups.
|
||
|
||
2004-07-11 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/widgets/gimpdevices.c (gimp_devices_check_change): Applied a
|
||
patch from Robert Ögren, moved here from toolbox_check_device().
|
||
Only change devices if the event came from a widget that accepts
|
||
extension events. Fixes bug #115774.
|
||
|
||
2004-07-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimp-utils.[ch] (gimp_parameters_append)
|
||
(gimp_parameters_append_valist)
|
||
(gimp_parameters_free): new utility functions which create and
|
||
destroy GParameter arrays for g_object_newv().
|
||
|
||
* app/gui/gui-vtable.c (gui_pdb_dialog_new): use them.
|
||
|
||
2004-07-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
Removed any remaining GUI dependency from the PDB wrappers:
|
||
|
||
* app/core/gimp.[ch]: added vtable entries for the display and
|
||
help stuff.
|
||
|
||
* app/widgets/gimphelp.[ch]: renamed gimp_help() to
|
||
gimp_help_show().
|
||
|
||
* app/gui/gui-vtable.c: implement the new display and help vtable
|
||
entries.
|
||
|
||
* tools/pdbgen/pdb.pl
|
||
* tools/pdbgen/pdb/display.pdb
|
||
* tools/pdbgen/pdb/help.pdb: use the new functions of the Gimp
|
||
object instead of using stuff from display/ and widgets/.
|
||
|
||
* tools/pdbgen/app.pl: removed bad hacks which enabled including
|
||
stuff from gui/, display/ and widgets/.
|
||
|
||
* app/Makefile.am: link widgets-enums.o, display-enums.o and
|
||
gimpdisplayoptions.o into the gimp-console binary because they are
|
||
needed for the config system and don't depend on any GUI stuff.
|
||
|
||
* app/pdb/Makefile.am: s/GTK_CFLAGS/GDK_PIXBUF_CFLAGS/
|
||
|
||
* app/pdb/display_cmds.c
|
||
* app/pdb/help_cmds.c: regenerated.
|
||
|
||
2004-07-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/quit-dialog.c (quit_dialog_new): let the labels line-wrap.
|
||
|
||
2004-07-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/display/gimpdisplay-foreach.[ch]: added new function
|
||
gimp_displays_get_dirty_images().
|
||
|
||
* app/gui/quit-dialog.c: show a container treeview of all dirty
|
||
images in the quit dialog. Still work in progress...
|
||
|
||
2004-07-09 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* gimp/plug-ins/gfig/gfig-circle.c
|
||
* gimp/plug-ins/gfig/gfig-dialog.c
|
||
* gimp/plug-ins/gfig/gfig-dobject.c
|
||
* gimp/plug-ins/gfig/gfig-ellipse.c
|
||
* gimp/plug-ins/gfig/gfig-poly.c
|
||
* gimp/plug-ins/gfig/gfig-preview.c
|
||
* gimp/plug-ins/gfig/gfig-star.c
|
||
* gimp/plug-ins/gfig/gfig-style.c
|
||
* gimp/plug-ins/gfig/gfig-style.h
|
||
* gimp/plug-ins/gfig/gfig.c
|
||
* gimp/plug-ins/gfig/gfig.h: Made FG, BG, and pattern fill work for
|
||
fillable objects; other miscellaneous cleanups and minor fixes.
|
||
|
||
2004-07-09 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/gui.c: removed the quit dialog code here.
|
||
|
||
* app/gui/Makefile.am
|
||
* app/gui/quit-dialog.[ch]: added new files that hold the old code
|
||
for now.
|
||
|
||
2004-07-09 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/pdb/procedural_db.c: #include <glib-object.h> instead of
|
||
<gtk/gtk.h>.
|
||
|
||
2004-07-09 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/gui/Makefile.am
|
||
* app/gui/brush-select.[ch]
|
||
* app/gui/font-select.[ch]
|
||
* app/gui/gradient-select.[ch]
|
||
* app/gui/palette-select.[ch]
|
||
* app/gui/pattern-select.[ch]: removed...
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimppdbdialog.[ch]
|
||
* app/widgets/gimpdataselect.[ch]
|
||
* app/widgets/gimpbrushselect.[ch]
|
||
* app/widgets/gimpgradientselect.[ch]
|
||
* app/widgets/gimppaletteselect.[ch]
|
||
* app/widgets/gimppatternselect.[ch]
|
||
* app/widgets/gimpfontselect.[ch]: ...and added here as a
|
||
hierarchy of widgets.
|
||
|
||
* app/widgets/gimpdatafactoryview.h: removed typdef
|
||
GimpDataEditFunc, it's in widgets-types.h now.
|
||
|
||
* app/gui/convert-dialog.c: changed accordingly.
|
||
|
||
* app/core/gimp.[ch]: added vtable entries for creating, closing
|
||
and setting PDB dialogs.
|
||
|
||
* app/gui/gui-vtable.c: implement the vtable entries using the new
|
||
widgets.
|
||
|
||
* tools/pdbgen/pdb/brush_select.pdb
|
||
* tools/pdbgen/pdb/font_select.pdb
|
||
* tools/pdbgen/pdb/gradient_select.pdb
|
||
* tools/pdbgen/pdb/palette_select.pdb
|
||
* tools/pdbgen/pdb/pattern_select.pdb: use the new functions of
|
||
the Gimp object to create / manage the selection dialogs. The
|
||
generated files don't depend on GUI stuff any longer.
|
||
|
||
* app/pdb/brush_select_cmds.c
|
||
* app/pdb/font_select_cmds.c
|
||
* app/pdb/gradient_select_cmds.c
|
||
* app/pdb/palette_select_cmds.c
|
||
* app/pdb/pattern_select_cmds.c: regenerated.
|
||
|
||
2004-07-09 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/file-save-dialog.c (file_save_overwrite): improved text
|
||
of the dialog.
|
||
|
||
2004-07-09 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpdialog.c (gimp_dialog_class_init): document
|
||
that "help-func" and "help-id" properties have been added for 2.2.
|
||
|
||
2004-07-09 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimphistogrameditor.c
|
||
(gimp_histogram_editor_menu_update): reverted my last change.
|
||
(gimp_histogram_editor_item_visible): fix the problem here instead.
|
||
|
||
2004-07-08 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimpdialog.c: removed "role" property because
|
||
GtkWindow has an equivalent property now. Added "help-func" and
|
||
"help-id" construct properties.
|
||
|
||
* app/widgets/gimptexteditor.c
|
||
* app/widgets/gimptooldialog.c
|
||
* app/widgets/gimpviewabledialog.c: removed calls to
|
||
gimp_help_connect() and pass help_func and help_id to
|
||
g_object_new().
|
||
|
||
2004-07-08 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimphelpui.c (gimp_context_help): fixed typo in
|
||
API docs.
|
||
|
||
2004-07-08 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist/Presets: converted the newlines in the
|
||
descriptions to whitespaces, so they'll simply wrap (in accordance
|
||
with making the description label wrappable).
|
||
|
||
2004-07-08 Shlomi Fish <shlomif@iglu.org.il>
|
||
|
||
* plug-ins/gimpressionist: Various Gimpressionist Cleanups. Made most
|
||
remaining non-static global variables static, and created functions
|
||
that manipulate them. Created new headers. Renamed some variables and
|
||
functions to make their names more menanigful.
|
||
|
||
2004-07-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimphistogrameditor.c
|
||
(gimp_histogram_editor_menu_update): set the active item of the
|
||
combo-box after changing the visibility filter.
|
||
|
||
2004-07-08 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimppropwidgets.c (gimp_prop_boolean_combo_box_notify):
|
||
same fix as below.
|
||
|
||
2004-07-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimppropwidgets.c (gimp_prop_enum_combo_box_notify):
|
||
block gimp_prop_enum_combo_box_callback() before changing the
|
||
combo-box.
|
||
|
||
2004-07-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpsessioninfo.c: only write aux-info for properties
|
||
that have been changed from their default values.
|
||
|
||
* app/widgets/gimphistogrameditor.c: some code cleanup.
|
||
|
||
2004-07-08 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpselectiondata.[ch]: added a "const gchar *format"
|
||
parameter to gimp_selection_data_set_pixbuf() which selects the
|
||
format in which to encode the pixbuf (was defaulting to "png"
|
||
before).
|
||
|
||
* app/widgets/gimpclipboard.c: when copying, offer all formats which
|
||
are savable with GdkPixbuf. Added a GimpClipboard struct which is
|
||
attached to the Gimp and which stores all the persistent data
|
||
needed by the clipboard. Renamed some private functions.
|
||
|
||
(unfortunately this change breaks pasting to AbiWord:
|
||
http://bugzilla.abisource.com/show_bug.cgi?id=7068)
|
||
|
||
2004-07-08 Sven Neumann <sven@gimp.org>
|
||
* app/config/gimpconfig-deserialize.c
|
||
* app/config/gimpconfig-serialize.c: removed redundant casts.
|
||
|
||
* app/widgets/gimpsessioninfo.[ch]: added convenience functions to
|
||
get and set aux-info based on object properties.
|
||
|
||
* app/widgets/gimphistogrameditor.c: use the new functions to save
|
||
a histogram's channel and scale in the sessionrc.
|
||
|
||
2004-07-07 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpclipboard.c: sort the list of pixbuf formats so
|
||
that PNG is the preferred format and GIF and JPEG come last.
|
||
|
||
2004-07-07 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/gfig/*.[ch]: Use single centralized functions to
|
||
create, load, and save objects, instead of separate functions
|
||
for each type of object. A few other miscellaneous fixes.
|
||
|
||
2004-07-07 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpclipboard.[ch]: changed to allow pasting any
|
||
GdkPixbuf supported format (makes pasting from OpenOffice
|
||
work). Cleaned up a bit to perpare pasting of SVG data.
|
||
|
||
2004-07-07 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimplayer.c (gimp_layer_new_from_tiles): add an alpha
|
||
channel if the src tile-manager doesn't have one. Warn on
|
||
unsupported type conversions instead of silently doing the wrong
|
||
thing. Fixes bug #145482.
|
||
|
||
* app/core/gimpbuffer.c: cosmetics.
|
||
|
||
2004-07-07 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/gui/Makefile.am
|
||
* app/gui/clipboard.[ch]: removed...
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/gimpclipboard.[ch]: ...and added here.
|
||
|
||
* app/actions/edit-commands.c
|
||
* app/gui/gui.c: changed accordingly.
|
||
|
||
2004-07-07 Michael Natterer <mitch@gimp.org>
|
||
|
||
Made the undo system robust against the currently pushed undo
|
||
being too large according to prefs settings. Fixes bug #145379.
|
||
|
||
* app/core/gimpimage-undo.[ch] (gimp_image_undo_push_undo)
|
||
(gimp_image_undo_group_end): emit "undo-event" *before* calling
|
||
gimp_image_undo_free_space() so the undo history doesn't try to
|
||
remove an item that has never been added.
|
||
|
||
(gimp_image_undo_push_undo): added boolean return value indicating
|
||
if the undo could be pushed (FALSE means the undo was to large
|
||
and was discarded right away).
|
||
|
||
(gimp_image_undo_push_item): return NULL if the above returned
|
||
FALSE.
|
||
|
||
* app/core/gimpimage-undo-push.c (gimp_image_undo_push_text_layer):
|
||
changed accordingly.
|
||
|
||
2004-07-07 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/common/jpeg.c: Don't try to load EXIF data if any warnings
|
||
happened, cause that likely means corruption and libexif doesn't
|
||
handle that very happily. Addresses bug #145212. Perhaps the error and
|
||
warning messages should be propagated to the user in the GUI somehow,
|
||
currently they are not.
|
||
|
||
2004-07-07 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/edit-actions.c (edit_actions): added "..." to "Clear
|
||
undo history" because it has a confirmation dialog.
|
||
|
||
* app/actions/edit-commands.c: cleanup: moved static functions to
|
||
the end of the file and prototyped them.
|
||
|
||
2004-07-07 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimphistogramview.c (gimp_histogram_view_expose):
|
||
fixed a drawing bug I introduced earlier today.
|
||
|
||
2004-07-07 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/view-actions.c
|
||
* app/actions/view-commands.[ch]: added actions and callbacks for
|
||
scrolling the view. Not used in menus but useful for controllers.
|
||
|
||
2004-07-07 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimpeditselectiontool.c
|
||
(gimp_edit_selection_tool_key_press): adapt the arrow key velocity
|
||
to the display scale factor. Please test and complain if you
|
||
dislike this behaviour.
|
||
|
||
* themes/Default/images/Makefile.am
|
||
* themes/Default/images/stock-color-pick-from-screen-16.png: new
|
||
icon drawn by Jimmac.
|
||
|
||
* libgimpwidgets/gimpstock.[ch]: register the new icon.
|
||
|
||
* libgimpwidgets/gimppickbutton.c: use it for the screen color
|
||
picker instead of reusing the color picker tool icon.
|
||
|
||
2004-07-06 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/gfig/*.[ch]: a bunch of code clean-up and
|
||
debugging. Created "classes" for the objects, and
|
||
attached functions to classes rather than objects.
|
||
|
||
2004-07-06 Sven Neumann <sven@gimp.org>
|
||
|
||
Added an RGB histogram based on a patch by Tor Lillqvist. Fixes
|
||
bug #145401.
|
||
|
||
* app/base/base-enums.[ch]: added GIMP_HISTOGRAM_RGB, don't export
|
||
it to the PDB.
|
||
|
||
* app/base/gimphistogram.c: implemented histogram functions for
|
||
the RGB mode.
|
||
|
||
* app/base/levels.c
|
||
* app/tools/gimpcurvestool.c
|
||
* app/tools/gimplevelstool.c
|
||
* app/widgets/gimpcolorbar.c
|
||
* app/widgets/gimphistogrameditor.c: handle the new enum value.
|
||
|
||
* app/widgets/gimphistogramview.c: for GIMP_HISTOGRAM_RGB mode,
|
||
draw a histogram that shows the RGB channels simultaneously
|
||
|
||
2004-07-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpmodule/gimpmodule.c: comply with C99 aliasing rules.
|
||
|
||
2004-07-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpwidgets-utils.c (gimp_menu_position)
|
||
(gimp_button_menu_position): call gtk_menu_set_monitor() only
|
||
for GTK+ < 2.4.4 and added a #warning about it.
|
||
|
||
2004-07-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gimpressionist: applied patch from Shlomi Fish that
|
||
fixes confusion of filenames and user-visible object names (bug
|
||
#132621). Also removed function remove_trailing_whitespace() that
|
||
used to duplicate functionality from GLib and updated
|
||
preset_create_filename().
|
||
|
||
2004-07-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimppreviewrenderer.c
|
||
(gimp_preview_renderer_set_viewable): queue an idle update when
|
||
setting the viewable to NULL so the view gets cleared correctly.
|
||
|
||
(gimp_preview_renderer_idle_update): call
|
||
gimp_preview_renderer_update() even if renderer->viewable is NULL
|
||
so clearing the viewable gets propagated to the GUI.
|
||
|
||
Moved clearing the viewable and removing the idle from
|
||
GObject::finalize() to GObject::dispose() because calling
|
||
set_viewable() with a NULL viewable triggers typechecking casts
|
||
and queuing idle functions, which is not nice in finalize().
|
||
|
||
2004-07-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* modules/Makefile.am (libcdisplay_proof_la_LIBADD): added back
|
||
$(LCMS_LIBS) that I had accidentally removed.
|
||
|
||
2004-07-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpvectorstreeview.c (gimp_vectors_tree_view_drag_svg):
|
||
return the proper type.
|
||
|
||
2004-07-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontainertreeview.c: connect to
|
||
"editing-canceled" of the name cell renderer and restore the
|
||
original text in the callback. Doesn't work reliably until GTK+
|
||
bug #145463 is fixed.
|
||
|
||
2004-07-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/plug-in/plug-in-rc.c (plug_in_icon_deserialize): fixed a
|
||
compiler warning.
|
||
|
||
* plug-ins/common/dog.c: removed some redundant casts and other
|
||
trivial cleanups.
|
||
|
||
2004-07-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcontroller.h: removed #define
|
||
GIMP_CONTROLLER_PARAM_SERIALIZE.
|
||
|
||
* libgimpmodule/gimpmoduletypes.h: added
|
||
GIMP_MODULE_PARAM_SERIALIZE instead.
|
||
|
||
* modules/controller_linux_input.c
|
||
* modules/controller_midi.c: changed accordingly.
|
||
|
||
* modules/cdisplay_colorblind.c
|
||
* modules/cdisplay_gamma.c
|
||
* modules/cdisplay_highcontrast.c
|
||
* modules/cdisplay_proof.c: made the new properties serializable.
|
||
|
||
2004-07-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/Makefile.am (enum_headers): don't scan
|
||
app/paint-funcs/paint-funcs-types.h for enums.
|
||
|
||
* app/paint-funcs/paint-funcs-types.h: removed /*< pdb-skip >*/
|
||
|
||
* app/core/core-types.h: reordered opaque typedefs to somehow
|
||
match the categories in the comments.
|
||
|
||
2004-07-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/core-types.h: removed enum SizeType.
|
||
|
||
* app/text/text-enums.h: added it as enum GimpSizeType and added
|
||
comment that it's for backward compatibility only.
|
||
|
||
* tools/pdbgen/Makefile.am
|
||
* tools/pdbgen/pdb/text_tool.pdb: changed accordingly.
|
||
|
||
* libgimp/gimpenums.h
|
||
* plug-ins/pygimp/gimpenums.py
|
||
* plug-ins/script-fu/script-fu-constants.c
|
||
* tools/pdbgen/enums.pl: regenerated (pdbgen insisted on
|
||
reordering the enums).
|
||
|
||
2004-07-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/core-types.h: #define MIN and MAX values for
|
||
GimpCoords.pressure, .tilt and .wheel.
|
||
|
||
* app/display/gimpdisplayshell-callbacks.c
|
||
(gimp_display_shell_get_event_coords)
|
||
(gimp_display_shell_get_device_coords): use the #defines instead
|
||
of hardcoded magic values when CLAMP()ing event or device values.
|
||
|
||
2004-07-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* modules/Makefile.am: link all modules with libgimpmodule.
|
||
|
||
2004-07-05 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/common/dog.c: improved defaults. use gimp_invert()
|
||
instead of rolling own. Use nasty hack to get previews to
|
||
work with grayscale images. Accept grayscale images.
|
||
|
||
2004-07-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpdata.[ch] (gimp_data_create_filename): Removed the
|
||
basename parameter and use the object name instead. Convert it to
|
||
the filesystem encoding.
|
||
|
||
* app/core/gimpdatafactory.c: changed accordingly.
|
||
|
||
2004-07-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gimpressionist: applied patch from Shlomi Fish that
|
||
fixes a number of bugs in the gimpressionst plug-in (bug #145309).
|
||
|
||
Also added some const qualifiers, cleaned up includes and removed
|
||
degtorad() and radtodeg() functions that used to duplicate
|
||
functionality from libgimpmath.
|
||
|
||
2004-07-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimptemplateview.c
|
||
(gimp_template_view_tree_name_edited): removed unused local variables.
|
||
|
||
2004-07-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig-dialog.c: don't g_free() a GdkPixbuf, it's an
|
||
object. Removed trailing whitespace.
|
||
|
||
* plug-ins/gfig/gfig-preview.c (draw_background): fixed declaration.
|
||
|
||
2004-07-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimpcolorizetool.c (gimp_colorize_tool_initialize):
|
||
return TRUE if initialization was successful. Makes the
|
||
tool->drawable pointer being set correctly by the calling code and
|
||
fixes bugs where colorize was leaving the drawable in a modified
|
||
but non-undoable state when cancelling or changing images.
|
||
|
||
2004-07-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* modules/cdisplay_proof.c: use object properties for the
|
||
configurable values.
|
||
|
||
2004-07-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpchannel.[ch]: added signal "color-changed" and emit
|
||
it in gimp_channel_set_color() and gimp_channel_set_opacity().
|
||
|
||
* app/core/gimpimage-qmask.[ch]: added new functions
|
||
gimp_image_set,get_qmask_color().
|
||
|
||
* app/core/gimpimage.[ch]: install a "color-changed" handler on
|
||
gimage->channels and update gimage->qmask_color when the qmask's
|
||
color changes. Fixes bug #145361.
|
||
|
||
* app/actions/qmask-commands.c: use the new qmask color API.
|
||
|
||
2004-07-04 Simon Budig <simon@gimp.org>
|
||
|
||
* app/actions/dialogs-commands.c
|
||
* app/display/gimpdisplayshell-dnd.c
|
||
* app/gui/preferences-dialog.c
|
||
* app/tools/gimppainttool.c
|
||
* app/widgets/gimpdeviceinfo.c
|
||
* app/widgets/gimpitemtreeview.c
|
||
* plug-ins/imagemap/imap_selection.c
|
||
* tools/pdbgen/pdb/gradients.pdb: Small changes to make GIMP
|
||
CVS compile with gcc 2.95 again. Mostly double semicolons and
|
||
variable declarations after other stuff. Spotted by Martin
|
||
Renold.
|
||
|
||
* app/pdb/gradients_cmds.c: regenerated.
|
||
|
||
(there is one issue left, see his patch at
|
||
http://old.homeip.net/martin/gcc-2.95.diff, I did not
|
||
copy the #define va_copy __va_copy, since I don't know
|
||
what happens here.)
|
||
|
||
2004-07-04 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/gfig/gfig-dialog.[ch]:
|
||
* plug-ins/gfig/gfig-style.[ch]:
|
||
* plug-ins/gfig/notes.txt: New files.
|
||
* plug-ins/gfig/*.[ch]: Complete reworking of the gfig plug-in.
|
||
See 'notes.txt' for a summary of what has changed, and how to use
|
||
it now. Plenty of bugs have been introduced, which will take a
|
||
while to straighten out.
|
||
|
||
2004-07-04 Tor Lillqvist <tml@iki.fi>
|
||
|
||
* app/core/gimpdrawable-equalize.c (gimp_drawable_equalize): Drop
|
||
a couple of unused variables.
|
||
|
||
* libgimpmodule/gimpmodule.def: Add gimp_module_register_enum.
|
||
|
||
2004-07-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpmodule/gimpmodule.[ch]: added gimp_module_register_enum(),
|
||
a function to register an enum type for a GTypeModule.
|
||
|
||
* modules/cdisplay_colorblind.c: use an object property for the
|
||
color deficiency enum.
|
||
|
||
2004-07-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/channel_mixer.c: don't attempt to store a
|
||
pointer to the last used filename in the plug-in parameter
|
||
struct. Fixes bug #145380.
|
||
|
||
2004-07-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* modules/cdisplay_gamma.c
|
||
* modules/cdisplay_highcontrast.c: added object properties for
|
||
configurable values.
|
||
|
||
* app/widgets/gimpcolordisplayeditor.c
|
||
* libgimpwidgets/gimpcolordisplaystack.c
|
||
* modules/cdisplay_colorblind.c
|
||
* modules/cdisplay_proof.c: cosmetic changes.
|
||
|
||
2004-07-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpcontext.[ch]: added context->serialize_props mask
|
||
which enables specifying exactly which properties will be
|
||
serialized. Also fixes a bug that prevented undefined properties
|
||
from being serialized, breaking tool_options and device status
|
||
serialization.
|
||
|
||
* app/core/gimptoolinfo.c (gimp_tool_info_new): make only the
|
||
properties in the tool_info->context_props mask serializable, also
|
||
configure/initialize tool_info->tool_options.
|
||
|
||
* app/tools/gimp-tools.c (gimp_tools_register): removed
|
||
tool_options initialization that is now done in
|
||
gimp_tool_info_new().
|
||
|
||
* app/widgets/gimpdeviceinfo.c: make only the properties in
|
||
GIMP_DEVICE_INFO_CONTEXT_MASK serializable.
|
||
|
||
* app/widgets/gimpdevicestatus.c: add the device table to its
|
||
parent container again. Fixes "missing" devices.
|
||
|
||
* app/core/gimptooloptions.c
|
||
* app/widgets/gimpdevices.c: cleanup / code review.
|
||
|
||
2004-07-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimppainttool.c (gimp_paint_tool_cursor_update): if
|
||
the color tool is enabled, skip cursor hiding entirely.
|
||
|
||
2004-07-03 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/dog.c (dog): removed #ifdef'ed code that isn't
|
||
any longer needed.
|
||
|
||
2004-07-02 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/tools/gimptransformoptions.[ch]:
|
||
* app/tools/gimptransformtool.c:
|
||
* app/tools/tools-enums.[ch]: Replaced "Preview" checkbutton with
|
||
a combobox with options "Outline", "Grid", "Image", and
|
||
"Image + Grid". Addresses bug #108172.
|
||
|
||
2004-07-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/edit-actions.c: don't let the Paste menu items
|
||
sensitivity depend on the availability of clipboard data because
|
||
we aren't notified when the GDK clipboard changes.
|
||
|
||
2004-07-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/Makefile.am
|
||
* app/gui/clipboard.[ch]: new files implementing a clipboard for
|
||
image data based on GDK_SELECTION_CLIPBOARD (bug #133247).
|
||
|
||
* app/actions/edit-actions.c
|
||
* app/actions/edit-commands.c: use the new clipboard API.
|
||
|
||
* app/gui/gui.c: initialize and shutdown the clipboard.
|
||
|
||
* app/core/gimpbuffer.c: cosmetics.
|
||
|
||
* app/actions/actions.c
|
||
* app/menus/menus.c: added sanity checks to exit functions.
|
||
|
||
* app/display/gimpdisplayshell-dnd.[ch]: let
|
||
gimp_display_shell_drop_svg() take a guchar * buffer.
|
||
|
||
* app/widgets/gimpselectiondata.c (gimp_selection_data_get_pixbuf):
|
||
fixed the implementation.
|
||
|
||
2004-07-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/gimpressionist/Makefile.am
|
||
* plug-ins/gimpressionist/*.[ch]: applied patch from Shlomi Fish
|
||
that massively cleans up gimppressionist (touching all files and
|
||
addding some new ones) and adds a simple PDB interface for
|
||
selecting one of the previously created presets.
|
||
Fixes bugs #145191, #144913 and #144922.
|
||
|
||
2004-07-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* configure.in: bumped version number to 2.1.2.
|
||
|
||
2004-07-01 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* plug-ins/common/align_layers.c: there seems to be no reason why
|
||
this plug-in should not work on INDEXED* images, added it to the
|
||
registered image types
|
||
|
||
2004-07-01 Roman Joost <roman@bromeco.de>
|
||
|
||
* plug-ins/script-fu/scripts/blend-anim.scm
|
||
* plug-ins/script-fu/scripts/glossy.scm
|
||
* plug-ins/script-fu/scripts/test-sphere.scm: fixed typos
|
||
|
||
2004-07-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpselectiondata.[ch]: added (yet unused) functions
|
||
gimp_selection_data_[get|set]_pixbuf().
|
||
|
||
2004-07-01 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpfgbgarea.[ch]: implement GtkWidget::drag_motion()
|
||
and set the FG/BG depending on where the color was dropped. Also
|
||
set the drag status accordingly so the cursor indicates whether
|
||
dropping will have an effect or not. Fixes bug #145219.
|
||
|
||
2004-07-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimptemplate.c: do like Liam taught us and use the
|
||
golden ratio as default for new images.
|
||
|
||
2004-06-30 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/tools/gimppainttool.c (gimp_paint_tool_cursor_update):
|
||
Chain up if the color tool is enabled. This fixes the problem of
|
||
the color picker cursor not appearing when using a paint tool
|
||
in color picking mode while "Show Paint Tool Cursor" is off.
|
||
|
||
2004-06-30 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* libgimp/gimpdrawable.c: moved call to
|
||
_gimp_tile_cache_flush_drawable() from gimp_drawable_detach() to
|
||
gimp_drawable_flush(), to resolve problem described in bug
|
||
#145051.
|
||
|
||
2004-06-30 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/plug-in/plug-ins.[ch] (plug_ins_init): added a GimpContext
|
||
parameter and use it to start plug-ins.
|
||
|
||
* app/core/gimp.c (gimp_real_restore): pass the user context.
|
||
Restores script-fu's access to the global FG, FG, brush, ...
|
||
|
||
2004-06-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/core-enums.c
|
||
* app/display/display-enums.c
|
||
* app/paint/paint-enums.c
|
||
* app/text/text-enums.c
|
||
* app/widgets/widgets-enums.c: regenerated.
|
||
|
||
2004-06-30 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/actions/file-commands.c: revert previous change that was
|
||
intended to fix bug #141971.
|
||
|
||
2004-06-30 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/*/*-enums.h: did HIG-compliant capitalization in the right
|
||
place, instead of the auto-generated *-enums.c files.
|
||
|
||
2004-06-30 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpdnd.[ch]
|
||
* app/widgets/gimpselectiondata.[ch]
|
||
* app/widgets/gimpcontainertreeview.[ch]: changed "files" and "uris"
|
||
to "uri_list" in all function names, parameters and typedefs.
|
||
|
||
* app/widgets/gimpcontainertreeview-dnd.c
|
||
* app/widgets/gimpdocumentview.c
|
||
* app/widgets/gimplayertreeview.c
|
||
* app/widgets/gimptoolbox-dnd.c
|
||
* app/display/gimpdisplayshell-dnd.[ch]
|
||
* app/display/gimpdisplayshell.c: changed accordingly.
|
||
|
||
2004-06-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/maze/maze_face.c: made the dialog look a little less
|
||
clumsy.
|
||
|
||
2004-06-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/drawable.pdb
|
||
* libgimp/gimppixbuf.c: raised the maximum size for thumbnails
|
||
from 256 to 512 pixels.
|
||
|
||
* app/pdb/drawable_cmds.c
|
||
* libgimp/gimpdrawable_pdb.c: regenerated.
|
||
|
||
* plug-ins/gfig/gfig-preview.c
|
||
* plug-ins/gfig/gfig.c: redone Bill's fix using
|
||
gimp_image_get_thumbnail(). A lot simpler, renders the alpha
|
||
checkerboard and also works for grayscale images.
|
||
|
||
2004-06-30 Michael Natterer <mitch@gimp.org>
|
||
|
||
Fixed a 1.2 -> 2.0 regression that was forgotten:
|
||
|
||
* app/widgets/widgets-enums.[ch]: added enum GimpColorPickState
|
||
which can be one of { NEW, UPDATE }.
|
||
|
||
* app/widgets/gimppaletteeditor.[ch]: changed #if 0'ed function
|
||
gimp_palette_editor_update_color() to
|
||
gimp_palette_editor_pick_color() and restored the functionality of
|
||
creating/updating colors via this API
|
||
|
||
Changed button_press handler to only edit the color on double
|
||
click if it's really a double click on the same color.
|
||
Fixes bug #141381.
|
||
|
||
* app/tools/gimpcolorpickeroptions.[ch]: added boolean property
|
||
"add-to-palette" and a GUI for it.
|
||
|
||
* app/core/gimpmarshal.list
|
||
* app/tools/gimpcolortool.[ch]: added a GimpColorPickState
|
||
parameter to the "color_picked" signal. Pass NEW on button_press
|
||
and UPDATE on motion.
|
||
|
||
* app/tools/gimpcurvestool.c (gimp_curves_tool_color_picked)
|
||
* app/tools/gimplevelstool.c (gimp_levels_tool_color_picked)
|
||
* app/tools/gimppainttool.c (gimp_paint_tool_color_picked):
|
||
changed accordingly
|
||
|
||
* app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_picked):
|
||
If "add-to-palette" is TRUE, get the palette editor and call
|
||
gimp_palette_editor_pick_color().
|
||
|
||
2004-06-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpselectiondata.[ch]: renamed the SVG related
|
||
functions so that they deal with an anonymous data stream that
|
||
could as well be a PNG image.
|
||
|
||
* app/widgets/gimpdnd.[ch]
|
||
* app/widgets/gimpcontainertreeview-dnd.c: changed accordingly.
|
||
|
||
* app/display/gimpdisplayshell-dnd.[ch]
|
||
* app/vectors/gimpvectors-import.[ch]
|
||
* app/widgets/gimpcontainertreeview-dnd.c
|
||
* app/widgets/gimpvectorstreeview.c: use gsize for the length of
|
||
the buffer.
|
||
|
||
* app/widgets/gimpdnd.[ch]
|
||
* app/widgets/widgets-enums.[ch]: added GIMP_DND_TYPE_PNG which isn't
|
||
used yet.
|
||
|
||
2004-06-30 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimppalette.[ch] (gimp_palette_add_entry): take
|
||
const GimpRGB* instead of just GimpRGB*.
|
||
Converted tabs to spaces.
|
||
|
||
2004-06-30 Michael Natterer <mitch@gimp.org>
|
||
|
||
* widgets/gimpselectiondata.[ch] (gimp_selection_data_get_svg):
|
||
changed return value from gchar* to const gchar*. Renamed
|
||
parameters to be consistent with other SVG functions.
|
||
|
||
* widgets/gimpcontainertreeview-dnd.c
|
||
* widgets/gimpdnd.c: changed accordingly.
|
||
|
||
2004-06-30 Simon Budig <simon@gimp.org>
|
||
|
||
* app/vectors/gimpstroke.[ch]
|
||
* tools/pdbgen/pdb/paths.pdb: Applied a modified patch from
|
||
Geert Jordaens that implements the gimp-path-get-point-at-dist
|
||
PDB function (fixes bug #138754).
|
||
|
||
* app/pdb/paths_cmds.c: regenerated.
|
||
|
||
2004-06-30 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimptoolbox.c (gimp_toolbox_button_accel_changed):
|
||
do like GtkAccelLabel does and turn underscores in accels into
|
||
spaces so e.g. "Page_Up" becomes "Page Up".
|
||
|
||
2004-06-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell.c: reordered drop destinations
|
||
so vectors are preferred over SVG.
|
||
|
||
* app/vectors/gimpvectors-import.[ch]: added "gint position"
|
||
parameter to all import functions so the imported vectors can be
|
||
added at any position in the vectors stack.
|
||
|
||
* app/actions/vectors-commands.c
|
||
* app/display/gimpdisplayshell-dnd.c
|
||
* tools/pdbgen/pdb/paths.pdb: changed accordingly (pass -1 as
|
||
position).
|
||
|
||
* app/pdb/paths_cmds.c: regenerated.
|
||
|
||
* app/widgets/gimpvectorstreeview.c: implemented SVG DND from and
|
||
to the paths dialog.
|
||
|
||
2004-06-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontainertreeview-dnd.c: don't free the SVG data
|
||
after dropping, it's owned by GtkSelectionData.
|
||
|
||
2004-06-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpdnd.c: use gtk_target_list_add() instead of
|
||
gtk_target_list_add_table() because the latter prepends the
|
||
targets to the internal list which screws the order (== priority)
|
||
of DND targets.
|
||
|
||
* app/widgets/gimpselectiondata.c: added some more checks for
|
||
failed drops (selection_data->length < 0).
|
||
|
||
2004-06-29 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* plug-ins/common/unsharp.c: The preview's row buffer was
|
||
accidentally made way too large.
|
||
|
||
2004-06-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpwidgets-utils.[ch]: added new function
|
||
gimp_get_mod_string() which takes a GdkModifierType and returns
|
||
correctly formated strings for all shift,control,alt combinations.
|
||
|
||
* app/tools/gimpbucketfilloptions.c
|
||
* app/tools/gimpcolorpickeroptions.c
|
||
* app/tools/gimpconvolvetool.c
|
||
* app/tools/gimpcropoptions.c
|
||
* app/tools/gimpdodgeburntool.c
|
||
* app/tools/gimperasertool.c
|
||
* app/tools/gimpflipoptions.c
|
||
* app/tools/gimpmagnifyoptions.c
|
||
* app/tools/gimpmoveoptions.c
|
||
* app/tools/gimptransformoptions.c
|
||
* app/tools/gimpvectoroptions.c
|
||
* app/widgets/gimpchanneltreeview.c
|
||
* app/widgets/gimpcolormapeditor.c
|
||
* app/widgets/gimpdocumentview.c
|
||
* app/widgets/gimperrorconsole.c
|
||
* app/widgets/gimpgradienteditor.c
|
||
* app/widgets/gimpitemtreeview.c
|
||
* app/widgets/gimppaletteeditor.c
|
||
* app/widgets/gimpselectioneditor.c
|
||
* app/widgets/gimpthumbbox.c
|
||
* app/widgets/gimptooloptionseditor.c
|
||
* app/widgets/gimpvectorstreeview.c: use the new function instead
|
||
of gimp_get_mod_name_shift(),control(),alt(),separator(). This
|
||
kindof addresses the issue of configurable modifier keys but is
|
||
actually indended to ease translation of format strings ("%s" is
|
||
easier to get right than "%s%s%s").
|
||
|
||
2004-06-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
Allow all sorts of things to be dropped on or in between the
|
||
items of a GimpContainerTreeView:
|
||
|
||
* app/widgets/gimpcontainertreeview.[ch]: added more parameters to
|
||
GimpContainerTreeView::drop_possible() to specify where ecactly
|
||
the drop should take place (between or into items) and to support
|
||
dropping all sorts of things.
|
||
|
||
Renamed ::drop() to ::drop_viewable() and added ::drop_color(),
|
||
::drop_files() and ::drop_svg(), which cover all possible drop
|
||
types.
|
||
|
||
* app/widgets/gimpcontainertreeview-dnd.[ch]: changed accordingly.
|
||
Dispatch all kinds of drops to the resp. virtual functions.
|
||
|
||
* app/widgets/gimpitemtreeview.c: changed accordingly.
|
||
|
||
* app/widgets/gimplayertreeview.c: allow to drop URIs, colors
|
||
and patterns to the layers dialog. Fixes bugs #119506 and #139246.
|
||
|
||
2004-06-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/file/file-open.[ch] (file_open_layer): new utility function
|
||
which opens an image, flattens it if needed and returns the only
|
||
layer, converted for a passed destination image.
|
||
|
||
* app/display/gimpdisplayshell-dnd.c
|
||
(gimp_display_shell_drop_files): use the new function.
|
||
|
||
2004-06-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/gimpselectiondata.[ch]: new files containing the
|
||
code which encodes/decodes all sorts of stuff to/from its
|
||
GtkSelectionData representation. Used to live in gimpdnd.c
|
||
|
||
* app/widgets/gimpdnd.c: use the new functions (unclutters the
|
||
file quite a bit), converted tabs to spaces.
|
||
|
||
2004-06-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontainergridview.c:
|
||
#include "libgimpwidgets/gimpwidgets.h"
|
||
|
||
2004-06-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
Fixed bug #141930 while keeping bug #132322 fixed:
|
||
|
||
* app/base/curves.c (curves_lut_func)
|
||
* app/base/levels.c (levels_lut_func): changed meaning of channel
|
||
slots for GRAYA images: just as for GRAY images, expect the value
|
||
channel in slot 0 and the alpha channel in slot 1, so it matches
|
||
the meaning of slots of GimpHistogram (before this change, only
|
||
GRAY images had their value in slot 0 and GRAYA images had it in
|
||
slot 1, whereas the histogram had the value channel in slot 0,
|
||
which was breaking auto levels for GRAYA images).
|
||
|
||
* app/tools/gimpcurvestool.c
|
||
* app/tools/gimplevelstool.c
|
||
* tools/pdbgen/pdb/color.pdb: adjusted channel fiddling for GRAY
|
||
and GRAYA images accordingly.
|
||
|
||
* app/tools/gimpcurvestool.c (curves_update)
|
||
* app/tools/gimplevelstool.c (levels_update): call
|
||
gimp_color_bar_set_buffers() with the right buffers.
|
||
|
||
* app/pdb/color_cmds.c: regenerated.
|
||
|
||
2004-06-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/gui.c (gui_initialize_after_callback): select the
|
||
standard tool.
|
||
|
||
* app/tools/tool_manager.c: cosmetics.
|
||
|
||
2004-06-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimplevelstool.c: reverted fix for bug #141930. These
|
||
hacks are there because the enum used in levels doesn't match
|
||
the enum used by the combo box and the histogram widget.
|
||
|
||
2004-06-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimpclonetool.c (gimp_clone_tool_button_release):
|
||
removed again (tools must not draw outside GimpDrawTool::draw()).
|
||
|
||
(gimp_clone_tool_draw): removed check for gimp_draw_tool_is_active()
|
||
because the draw function would not be called if the draw tool was
|
||
inactive. Simplified check for whether or not to draw the src
|
||
location.
|
||
|
||
* app/tools/gimppainttool.c (gimp_paint_tool_button_release):
|
||
pause/resume the draw tool across all button_release actions so
|
||
tools (clone) have a chance to draw different things depending on
|
||
gimp_tool_control_is_active(tool->control). Fixes bug #145022.
|
||
|
||
2004-06-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/actions.c (action_select_object): added missing
|
||
return value.
|
||
|
||
2004-06-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/dog.c: applied HIG rules to the GUI and slightly
|
||
rearranged it to get a more compact layout. Applied GIMP coding
|
||
style.
|
||
|
||
2004-06-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpdrawable.c: removed wrong note about using
|
||
_gimp_tile_cache_flush_drawable() from the API docs.
|
||
|
||
2004-06-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/dog.c (dog): ifdef'ed out calls to
|
||
_gimp_tile_cache_flush_drawable() since it can't be used from a
|
||
plug-in. Removed trailing whitespace and redundant includes.
|
||
|
||
* libgimp/gimp.def: removed _gimp_tile_cache_flush_drawable again.
|
||
|
||
2004-06-28 Simon Budig <simon@gimp.org>
|
||
|
||
* app/tools/gimpvectortool.c: fixed drawing code to properly
|
||
update after deleting nodes via BackSpace/Delete.
|
||
|
||
2004-06-27 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/tools/gimplevelstool.c: removed two small chunks of code.
|
||
Fixes bug #141930. Possibly unfixes bug #132322.
|
||
|
||
2004-06-27 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* libgimp/gimp.def: added _gimp_tile_cache_flush_drawable because
|
||
it is used in a plug-in. See bug #145051.
|
||
|
||
2004-06-26 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* plug-ins/common/unsharp.c: Preview now works correctly with
|
||
RGBA and grayscale-alpha images. Fixes bug #144971.
|
||
|
||
2004-06-26 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/tools/gimpclonetool.c: added button_release callback
|
||
to fix bug #145022.
|
||
|
||
2004-06-26 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* plug-ins/common/unsharp.c: Use GTK_PREVIEW_GRAYSCALE if source
|
||
is grayscale or grayscale-alpha. Partial fix for bug #144971.
|
||
|
||
2004-06-25 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/common/unsharp.c: speed up preview by allocating tile
|
||
cache before creating dialog. Should fix bug #144972.
|
||
|
||
2004-06-25 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* plug-ins/common/zealouscrop.c: Moved Zealous Crop from
|
||
<Image>/Layer/Crop to <Image>/Image/Crop because it affects the
|
||
entire image.
|
||
|
||
2004-06-25 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/common/dog.c: added Difference of Gaussians edge
|
||
detect plug-in.
|
||
|
||
* plug-ins/common/plugin-defs.pl:
|
||
* plug-ins/common/Makefile.am: added dog and regenerated
|
||
Makefile.
|
||
|
||
2004-06-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/context-actions.c: added GIMP_ACTION_SELECT_SET
|
||
actions which set a generated brush's properties directly.
|
||
|
||
* app/actions/context-commands.c: adjust the range of possible
|
||
brush radius and aspect_ratio values to be actually usable.
|
||
|
||
2004-06-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpbrushgenerated.[ch]: reordered parameters and
|
||
members to be consistent with other places where generated
|
||
brushes are used. Check for errors when loading a brush and
|
||
utf8-validate its name. Cleanup.
|
||
|
||
* app/core/gimpbrush.c
|
||
* app/core/gimpbrushpipe.c: cleanup.
|
||
|
||
2004-06-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/gui/preferences-dialog.c (prefs_dialog_new): work around
|
||
GTK+ bug #143270 (set the cursor on the selected model path
|
||
instead of selecting the iter in the selection). Fixes random
|
||
theme switching when selecting the "Theme" page.
|
||
|
||
2004-06-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpbrushgenerated.c: added properties for all brush
|
||
parameters.
|
||
|
||
* app/widgets/gimpbrusheditor.c: listen to property changes of the
|
||
edited brush and update the scales accordingly.
|
||
|
||
2004-06-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/gui/preferences-dialog.c: more work on the controller page,
|
||
made integer controller properties editable.
|
||
|
||
* modules/controller_midi.c: allow to specify the MIDI channel to
|
||
generate events from. Default to -1 (all channels).
|
||
|
||
2004-06-24 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/gfig/gfig.[ch]:
|
||
* plug-ins/gfig/gfig-preview.c: Let gfig use a thumbnail of the
|
||
image as background for its preview, if the image is RGB and "Show
|
||
image" is checked in the Options tab. (Next best thing to
|
||
previewing in the image.)
|
||
|
||
2004-06-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontrollerinfo.[ch]: added a boolean property
|
||
"debug-events" and honor it when printing debugging output.
|
||
Should add an event console window so the user doesn't need to
|
||
have a terminal to inspect input module output.
|
||
|
||
* app/gui/prefereces-dialog.c: HIGified some forgotten labels.
|
||
Renamed the "Pointer Movement Feedback" frame to "Mouse Cursors".
|
||
Replaced some forgotten "Dir" with "Folder".
|
||
Made more GimpControllerInfo and GimpController properties
|
||
editable and cleaned up the controller page.
|
||
|
||
2004-06-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimppropwidgets.[ch]: added gimp_prop_label_new().
|
||
|
||
* app/widgets/gimpgrideditor.c: HIGified capitalization.
|
||
|
||
2004-06-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* modules/controller_linux_input.c
|
||
* modules/controller_midi.c: remember the source ID returned by
|
||
g_io_add_watch() and remove it when changing the device, so the
|
||
file descritor gets actually closed. Minor cleanups.
|
||
|
||
2004-06-24 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontrollerwheel.[ch]: renamed function
|
||
gimp_controller_wheel_scrolled() to
|
||
gimp_controller_wheel_scroll().
|
||
|
||
* app/display/gimpdisplayshell-callbacks.c
|
||
(gimp_display_shell_canvas_tool_events): changed accordingly.
|
||
|
||
2004-06-24 Michael Natterer <mitch@gimp.org>
|
||
|
||
* etc/controllerrc: fix typo in wheel controller mapping.
|
||
|
||
2004-06-24 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimptool.[ch]
|
||
* app/tools/tool_manager.[ch]: added boolean return value to
|
||
GimpTool::key_press() which indicates if the event was handled.
|
||
|
||
* app/tools/gimpcroptool.c
|
||
* app/tools/gimpeditselectiontool.[ch]
|
||
* app/tools/gimptransformtool.c
|
||
* app/tools/gimpvectortool.c: return TRUE if the key event was handled.
|
||
|
||
* app/tools/gimppainttool.c: removed key_press() implementation.
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpcontrollerkeyboard.[ch]: new controller class
|
||
which takes GdkEventKey and emits controller events for all
|
||
combinations of modifiers and cursor keys.
|
||
|
||
* app/widgets/gimpcontrollers.[ch]: added new function
|
||
gimp_controllers_get_keyboard().
|
||
|
||
* app/display/gimpdisplayshell-callbacks.c: if a key event was not
|
||
handled by the active tool, dispatch it to the keyboard controller.
|
||
|
||
* etc/controllerrc: add a keyboard controller which is configured
|
||
to do the same as the removed gimp_paint_tool_key_press().
|
||
|
||
2004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* libgimp/gimpdrawable.c: added some documentation for
|
||
a few important functions with no API docs.
|
||
|
||
2004-06-24 Sven Neumann <sven@gimp.org>
|
||
|
||
* Made 2.1.1 release.
|
||
|
||
2004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/actions/file-commands.c: make "Revert" only ask for
|
||
confirmation if image is dirty. Fixes bug #141971.
|
||
|
||
2004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/gui/*.c:
|
||
* app/widgets/*.c:
|
||
* etc/templaterc: HIGify capitalization. Should finish bug #123699
|
||
except for everything I missed or got wrong.
|
||
|
||
2004-06-24 Sven Neumann <sven@gimp.org>
|
||
|
||
* etc/controllerrc: commented out the linux_input controller
|
||
configuration.
|
||
|
||
2004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/tools/*.c: HIGify capitalization for dialogs. More
|
||
progress on bug #123699.
|
||
|
||
2004-06-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* modules/controller_midi.c: added utility function midi_event()
|
||
which assembles a GimpControllerEventValue and emits it.
|
||
|
||
2004-06-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpenumaction.[ch]
|
||
* app/widgets/gimppluginaction.[ch]
|
||
* app/widgets/gimpstringaction.[ch]: added parameters to the
|
||
gimp_*_action_selected() function so the "selected" signal can be
|
||
emitted with value != action->value. Changed GtkAction::activate()
|
||
implementations accordingly (pass action->value).
|
||
|
||
* app/widgets/gimpcontrollers.c: call gimp_enum_action_selected()
|
||
and pass the value of the GimpControllerEventValue instead of
|
||
temporarily replacing action->value and calling
|
||
gtk_action_activate().
|
||
|
||
* app/widgets/gimpcontrollerinfo.c: fixed debugging output.
|
||
|
||
2004-06-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint/gimpbrushcore.[ch]: added signal "set-brush" which is
|
||
G_SIGNAL_RUN_LAST so we can connect before and after the default
|
||
implementation. Moved the brush setting and outline invalidation
|
||
stuff to its default implementation. Also remember the outline's
|
||
width and height. Call gimp_brush_core_set_brush() from
|
||
gimp_brush_core_invalidate_cache() so "set-brush" is emitted
|
||
whenever a generated brush becomes dirty.
|
||
|
||
* app/tools/gimppainttool.c (gimp_paint_tool_button_press): don't
|
||
pause/resume but rather stop/start the draw_tool. Fixes straight
|
||
line preview aretefacts.
|
||
|
||
(gimp_paint_tool_oper_update): set the brush_core's brush before
|
||
starting the draw_tool.
|
||
|
||
(gimp_paint_tool_draw): never free the brush_core's cached brush
|
||
outline because the brush_core does that by itself now.
|
||
|
||
(gimp_paint_tool_set_brush)
|
||
(gimp_paint_tool_set_brush_after): new callbacks which pause and
|
||
resume the draw_tool. Fixes brush outline artefacts when modifying
|
||
the current brush e.g. by using the mouse wheel.
|
||
|
||
2004-06-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/context-commands.h: removed enum GimpContextSelectType.
|
||
|
||
* app/actions/actions-types.h: added enum GimpActionSelectType.
|
||
|
||
* app/actions/actions.[ch]: added utility functions
|
||
action_select_value() and action_select_object().
|
||
|
||
* app/actions/context-actions.c
|
||
* app/actions/context-commands.c: changed accordingly.
|
||
|
||
* app/actions/layers-actions.c
|
||
* app/actions/layers-commands.[ch]: merged the layer select
|
||
callbacks into one using the GimpActionSelectType functions. Added
|
||
actions and callbacks for modifying the active layer's opacity.
|
||
|
||
* app/menus/menus-types.h: #incude "actions/action-types.h".
|
||
|
||
* app/gui/gui-types.h: #incude "menus/menus-types.h".
|
||
|
||
* app/gui/preferences-dialog.c: allow to enable/disable input
|
||
controllers.
|
||
|
||
2004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/tools/gimpcurvestool.c: try again to revert.
|
||
|
||
2004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/tools/gimpcurvestool.c: reverted.
|
||
|
||
2004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/script-fu/scripts: HIG-ified capitalization on
|
||
all. Finishes this for everything in plug-ins. Bug #123699 is
|
||
now mostly fixed.
|
||
|
||
2004-06-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/composite/gimp-composite-regression.c: define timersub()
|
||
macro in case it's undefined. Patch by Tim Mooney, fixes 'make
|
||
check' on Tru64 (bug #144780).
|
||
|
||
2004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/tools/gimpcurvestool.c: added Store/Recall buttons for
|
||
one-click saving and loading of curves. Should create stock
|
||
labels for them. Hopefully resolves bug #75558.
|
||
|
||
2004-06-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/view-actions.c
|
||
* app/actions/view-commands.[ch]: added actions & callbacks to
|
||
configure the canvas padding color.
|
||
|
||
* app/widgets/gimphelp-ids.h
|
||
* menus/image-menu.xml.in: added the actions' help IDs and menu entries.
|
||
|
||
* app/display/display-enums.h: added /*< skip >*/'ed enum value
|
||
GIMP_CANVAS_PADDING_MODE_RESET.
|
||
|
||
* app/display/gimpdisplayshell-appearance.c
|
||
* app/display/gimpdisplayshell-callbacks.[ch]
|
||
* app/display/gimpdisplayshell-handlers.c
|
||
* app/display/gimpdisplayshell.[ch]: removed the canvas padding
|
||
button and its popup menu (fixes bug #142996). Instead, added a
|
||
toggle button which allows to zoom the image when the window is
|
||
resized (as known from sodipodi, except it doesn't work as nice
|
||
yet :-) improvements to the algorithm are welcome).
|
||
Cleaned up the GimpDisplayShell struct a bit and renamed some
|
||
of its members.
|
||
|
||
* libgimpwidgets/gimpstock.[ch]
|
||
* themes/Default/images/Makefile.am
|
||
* themes/Default/images/stock-zoom-follow-window-12.png: added new
|
||
icon for the new display toggle button.
|
||
|
||
2004-06-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimpclonetool.c (gimp_clone_tool_draw): chain up
|
||
unconditionally now that we draw the brush outline while
|
||
painting. Fixes brush outline artefacts on button_press and
|
||
button_release. Spotted by sjburges.
|
||
|
||
2004-06-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
|
||
the filename if the image is unnamed.
|
||
|
||
* configure.in
|
||
* app/sanity.c: depend on gtk+ >= 2.4.1.
|
||
|
||
* app/widgets/gimpthumbbox.[ch]: changed gimp_thumb_box_set_uris()
|
||
to gimp_thumb_box_take_uris() since the function takes ownership
|
||
of the list,
|
||
|
||
* app/widgets/gimpfiledialog.c: changed accordingly. Removed code
|
||
that worked around a problem in gtk+ < 2.4.1.
|
||
|
||
2004-06-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcolorarea.c (gimp_color_area_set_color): use
|
||
gimp_rgb_distance() for flat color areas. Fixes bug #144786.
|
||
|
||
2004-06-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/fileops.pdb: app/pdb/fileops_cmds.c is a
|
||
generated file, need to do the documentation change here.
|
||
|
||
* app/pdb/fileops_cmds.c
|
||
* libgimp/gimpfileops_pdb.c: regenerated.
|
||
|
||
2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/tools/gimptransformoptions.c: use radio buttons
|
||
for constraint options. Makes all options visible,
|
||
should resolve bug #68106.
|
||
|
||
2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/gui/file-save-dialog.c: to reduce clutter, hide overwrite
|
||
query dialog after user has responded.
|
||
|
||
2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/common/noisify.c: changed handling of alpha
|
||
channel in an attempt to deal with bug #72853.
|
||
Changed menu entry from "Noisify" to "Scatter RGB".
|
||
|
||
2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/pdb/fileops_cmds.c: fixed incorrect documentation for
|
||
gimp_file_load, which was the root cause of bug #118811.
|
||
|
||
2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins: finish implementing HIG capitalization in dialogs.
|
||
Scripts remain to be done. More progress on bug #123699.
|
||
|
||
2004-06-21 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/widgets-enums.[ch] (enum GimpCursorFormat): removed
|
||
value GIMP_CURSOR_FORMAT_PIXBUF_PREMULTIPLY because it's the job
|
||
of GDK to do that (it was GDK that was broken, not some of the X
|
||
servers).
|
||
|
||
* app/widgets/gimpcursor.c (gimp_cursor_new): premultiply the
|
||
cursor's pixels for GTK+ < 2.4.4.
|
||
|
||
2004-06-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/gui.c (gui_exit_callback): improved message in quit
|
||
dialog just in case that we don't manage to redo this dialog
|
||
before 2.2.
|
||
|
||
2004-06-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpwidgets.[ch]
|
||
* libgimpwidgets/gimpwidgets.def: added new utility function
|
||
gimp_label_set_attributes().
|
||
|
||
* app/display/gimpdisplayshell.c
|
||
* app/gui/preferences-dialog.c
|
||
* app/gui/resolution-calibrate-dialog.c
|
||
* app/widgets/gimpviewabledialog.c
|
||
* app/widgets/gimpwidgets-utils.c: use the new function.
|
||
|
||
* app/widgets/gimpcontainergridview.c
|
||
* app/widgets/gimphistogrameditor.c: display the name in italic.
|
||
|
||
* plug-ins/common/jpeg.c: display the file size in italic.
|
||
|
||
2004-06-20 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/common/url.c: if url does not end in a recognized
|
||
extension, open it as an unnamed image. Fixes bug #118811.
|
||
|
||
2004-06-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimphistogrambox.[ch]: removed the label between the
|
||
spinbuttons, it looks silly. Converted tabs to spaces, removed
|
||
trailing whitespace.
|
||
|
||
* app/widgets/gimphistogrameditor.c
|
||
* app/tools/gimpthresholdtool.c: changed accordingly.
|
||
|
||
2004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins: changed dialogs to follow HIG capitalization style
|
||
wherever they didn't. Scripts remain to be done. Partially
|
||
fixes bug #123699.
|
||
|
||
2004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/widgets/gimphistogrambox.[ch]:
|
||
* app/tools/gimpthresholdtool.c: Changed the threshold tool dialog
|
||
so that it uses a two-triangle-slider scale of the sort used in the
|
||
levels tool. Almost all of the changes are actually in the
|
||
histogram-box widget code, which is only used by the threshold
|
||
tool. Fixes bug #137521.
|
||
|
||
2004-06-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/jpeg.c: removed redundant hboxes and other
|
||
layout cleanups.
|
||
|
||
2004-06-20 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/display/gimpdisplayshell-scale.[ch]:
|
||
* app/display/gimpnavigationview.[ch]:
|
||
* app/actions/view-actions.c:
|
||
* app/actions/view-commands.[ch]:
|
||
* app/widgets/gimphelp-ids.h:
|
||
* menus/image-menu.xml.in: Changed "Zoom to Fit Window" command
|
||
to "Fit Image in Window" and added another command, "Fit Image
|
||
to Window", that zooms according to the opposite dimension. Fixes
|
||
bug #144597.
|
||
|
||
2004-06-19 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* libgimpwidgets/gimpwidgets.def: added missing
|
||
gimp_controller_* entries
|
||
|
||
2004-06-19 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* modules/controller_midi.c: #ifdef G_OS_WIN32 for an O_NONBLOCK
|
||
|
||
2004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/common/jpeg.c: more changes to save dialog. Moved
|
||
comment field to Advanced area. Don't set restart marker
|
||
frequency stuff insensitive. Changed range for quality
|
||
scale from 0-1 to 0-100 to follow the jpeg spec (but left
|
||
allowable range for pdb at 0-1 to avoid breaking anything).
|
||
|
||
2004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/tools/gimpscaletool.c: fixed my fix for bug # 68106, which
|
||
worked incorrectly for two of the control points.
|
||
|
||
2004-06-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* modules/controller_midi.c (midi_read_event): simplified
|
||
swallowing of SysEx messages and unwanted data bytes. Reordered
|
||
and commented stuff to be more readable.
|
||
|
||
2004-06-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* modules/Makefile.am
|
||
* modules/controller_midi.c: new controller for MIDI input. Maps
|
||
all note on and note off events and all MIDI controllers to
|
||
GimpContollerEvents. Should parse any MIDI stream. Code based on
|
||
blinkenmedia stuff from Daniel Mack.
|
||
|
||
2004-06-19 Sven Neumann <sven@gimp.org>
|
||
|
||
Applied a patch from Geert Jordaens that implements the
|
||
GtkStatusbar functionality in GimpStatusbar so that we can redo it
|
||
in order to fix bug #120175:
|
||
|
||
* app/core/gimpmarshal.list: added VOID: UINT, STRING.
|
||
|
||
* app/display/gimpstatusbar.[ch]: copied GtkStatusbar code.
|
||
|
||
* app/display/gimpdisplayshell.c: changed accordingly.
|
||
|
||
2004-06-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/ifscompose/ifscompose_utils.c (create_brush): use
|
||
G_SQRT2; some coding style cleanups.
|
||
|
||
2004-06-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/vectors/gimpbezierstroke.c (arcto_ellipsesegment): moved
|
||
array initialization out of variable declaration (bug #144632).
|
||
|
||
2004-06-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/vectors/gimpbezierstroke.c (arcto_ellipsesegment): use
|
||
G_SQRT2 to make circlemagic a constant value so we can initialize
|
||
the array on declaration. Fixes bug #144632.
|
||
|
||
2004-06-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* devel-docs/parasites.txt: document "exif-data" parasite.
|
||
|
||
2004-06-18 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/common/film.c: Don't use deprecated gimp_text functions,
|
||
clean up font name string handling a bit, default is now "Monospace"
|
||
instead of "Courier".
|
||
|
||
2004-06-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontrollers.c (gimp_controllers_event_mapped):
|
||
start supporting GIMP_CONTROLLER_EVENT_VALUE of type gdouble.
|
||
Assume the double value is in a [0.0..1.0] range and temporarily
|
||
change the value of the called GimpEnumAction to a range of
|
||
[0..1000] when invoking it. All still very hackish...
|
||
|
||
2004-06-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontrollerinfo.c (gimp_controller_info_event):
|
||
more debugging output.
|
||
|
||
2004-06-18 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* app/tools/gimpscaletool.c: changed algorithm for scaling when
|
||
aspect ratio is constrained, to fix strange behavior described
|
||
in bug # 68106.
|
||
|
||
2004-06-18 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/common/jpeg.c: redid save dialog along lines suggested
|
||
in bug # 138929
|
||
|
||
Only create an exif data parasite on loading file if the file actually
|
||
contains exif data.
|
||
|
||
Call exif data parasite "exif-data" instead of "jpeg-exif-data",
|
||
because it should be interchangeable with TIFF exif data.
|
||
|
||
2004-06-18 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/context-actions.c
|
||
* app/actions/context-commands.[ch]: added tons of new actions to
|
||
modify the current FG/BG color's RGB components.
|
||
|
||
Added new enum value GIMP_CONTEXT_SELECT_SET which allows to set
|
||
values, not only increase/decrease them.
|
||
|
||
Changed context_select_value() utility function to interpret
|
||
GimpEnumAction::value being >= GIMP_CONTEXT_SELECT_SET as settings
|
||
in a range from 0 to 1000. Yes, that's a hack...
|
||
|
||
2004-06-18 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/tools/gimptransformtool.c: reverted my fix to bug #144570.
|
||
|
||
2004-06-18 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/tools/gimpfuzzyselecttool.c: Fix fuzzy select menu label.
|
||
|
||
2004-06-18 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/tools/gimptransformtool.c (gimp_transform_tool_bounds):
|
||
If transforming a path, use the path bounds rather than the mask
|
||
bounds. Fixes bug #144570.
|
||
|
||
2004-06-17 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimp-utils.[ch]: added gimp_boolean_handled_accum().
|
||
|
||
* app/core/gimp.c
|
||
* app/widgets/gimpcontrollerinfo.c: use it.
|
||
|
||
2004-06-17 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpcontainer.c (gimp_container_deserialize): add newly
|
||
created children to the container *after* deserializing them so
|
||
GimpContainer::add() callbacks get the already deserialized
|
||
object.
|
||
|
||
* app/widgets/gimpcontrollers.c: connect to "add" and "remove" of
|
||
the controller list and remember / clear the wheel controller when
|
||
it appears / disappears.
|
||
|
||
2004-06-17 Sven Neumann <sven@gimp.org>
|
||
|
||
* autogen.sh: check for xsltproc and mention that the intltool
|
||
version mismatch is harmless.
|
||
|
||
2004-06-17 Pedro Gimeno <pggimeno@wanadoo.es>
|
||
|
||
* tools/pdbgen/pdb/paths.pdb: Fix typos and improve documentation.
|
||
Addresses bug #144267.
|
||
|
||
* app/pdb/paths_cmds.c
|
||
* libgimp/gimppaths_pdb.c: regenerated.
|
||
|
||
2004-06-17 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcontroller.[ch]: removed "enabled"
|
||
property. Removed GIMP_CONTROLLER_PARAM_SERIALIZE from the "name"
|
||
property because it's the hardware-determined name of this
|
||
controller instance.
|
||
|
||
* app/widgets/gimpcontrollerwheel.c
|
||
* modules/controller_linux_input.c: set the name.
|
||
|
||
* libgimpwidgets/gimpwidgets.h: #include gimpcontroller.h.
|
||
|
||
* app/widgets/gimpcontrollerinfo.[ch]: added "enabled" here
|
||
instead. Don't dispatch events if the controller is
|
||
disabled. Made everything work (not crash) with info->mapping
|
||
being NULL.
|
||
|
||
* etc/controllerrc: updated again with the changed format.
|
||
|
||
* app/widgets/gimpcontrollers.[ch]: added
|
||
gimp_controllers_get_list() which returns the container of
|
||
controllers.
|
||
|
||
* app/widgets/gimphelp-ids.h
|
||
* app/gui/preferences-dialog.c: added controller configuration
|
||
(can't change anything yet, just view the current settings).
|
||
Resurrected the "Input Devices" page and removed the "Session"
|
||
page by moving its widgets to other pages. Pack the various
|
||
"Save now"/"Clear now" buttons vertically, not horizontally.
|
||
Fixes bug #139069.
|
||
|
||
* themes/Default/images/preferences/Makefile.am
|
||
* themes/Default/images/preferences/controllers.png
|
||
* themes/Default/images/preferences/theme.png: new icons for new
|
||
prefs pages. Someone needs to make them nice...
|
||
|
||
2004-06-17 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell.c: GtkUIManager makes the menu bar
|
||
visible by default, hide it if options->show_menubar is FALSE.
|
||
Fixes bug #143243.
|
||
|
||
2004-06-17 Sven Neumann <sven@gimp.org>
|
||
|
||
* configure.in: bumped version to 2.1.1. Allow to disable the
|
||
build of the linux_input controller module.
|
||
|
||
2004-06-17 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/core/gimpdrawable-transform.c
|
||
(gimp_drawable_transform_tiles_affine): Make transforms (most
|
||
notably perspective transforms) conform exactly to specified
|
||
edges. Includes a patch by David Gowers. Fixes bug #144352.
|
||
|
||
2004-06-16 Manish Singh <yosh@gimp.org>
|
||
|
||
* modules/controller_linux_input.c: put BTN_{WHEEL,GEAR_DOWN,GEAR_UP}
|
||
usage in #ifdefs, since pre-2.6 kernels do not have them.
|
||
|
||
* modules/controller_linux_input.c (linux_input_read_event): n_bytes
|
||
should be a gsize.
|
||
|
||
2004-06-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/context-actions.c
|
||
* app/actions/context-commands.[ch]: added actions & callback
|
||
to select the first/last/prev/next tool.
|
||
|
||
2004-06-16 Simon Budig <simon@gimp.org>
|
||
|
||
* modules/controller_linux_input.c: removed BTN_MISC,
|
||
since it is the same as BTN_0 in the input.h header file.
|
||
|
||
2004-06-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcontroller.c (gimp_controller_get_event_name)
|
||
(gimp_controller_get_event_blurb): always return a non-NULL
|
||
string (return "<invalid event id>" as fallback).
|
||
|
||
* modules/controller_linux_input.c: reenabled button event
|
||
dispatching.
|
||
|
||
* app/widgets/gimpcontrollerinfo.c: fixed debugging output.
|
||
|
||
2004-06-16 Simon Budig <simon@gimp.org>
|
||
|
||
* modules/controller_linux_input.c: break out of the
|
||
loop after we handled the first matching rel_event.
|
||
|
||
2004-06-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcontroller.[ch]: added #define
|
||
GIMP_CONTROLLER_PARAM_SERIALIZE. Made all properties serializable.
|
||
|
||
* modules/controller_linux_input.c: made "device-name"
|
||
serializable.
|
||
|
||
* app/config/gimpconfig-params.h: added macro
|
||
GIMP_CONFIG_INSTALL_PROP_POINTER() which needs to be handled
|
||
by custom (de)serialize_property() implementations.
|
||
|
||
* app/config/gimpconfig-deserialize.c
|
||
* app/config/gimpconfig-serialize.c: made object (de)serialization
|
||
work for object properties which are *not* GIMP_PARAM_AGGREGATE.
|
||
Write/parse the exact type of the object to create to enable this.
|
||
|
||
* app/core/gimpmarshal.list: new marshaller for GimpControllerInfo.
|
||
|
||
* app/widgets/gimpcontrollerinfo.[ch]: implement GimpConfigInterface
|
||
and add "controller" and "mapping" properties. Add "event-mapped"
|
||
signal which carries the action_name.
|
||
|
||
* app/widgets/gimpcontrollers.c: removed all deserialization code
|
||
and simply (de)serialize the controller container. Install a
|
||
container handler for "event-mapped" and do the action_name ->
|
||
action mapping in the callback.
|
||
|
||
* etc/controllerrc: regenerated with new syntax. Delete your old one!
|
||
|
||
2004-06-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpcontrollerwheel.c
|
||
(gimp_controller_wheel_get_event_name): don't use gettext() here.
|
||
|
||
* modules/controller_linux_input.c: added more button events, set
|
||
the device name, some cleanup.
|
||
|
||
2004-06-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/plugin-defs.pl: changed dependencies for blur.
|
||
|
||
* plug-ins/common/Makefile.am: regenerated.
|
||
|
||
* plug-ins/common/blur.c: no need to include libgimpui.h any longer.
|
||
|
||
2004-06-16 Bill Skaggs <weskaggs@primate.ucdavis.edu>
|
||
|
||
* plug-ins/common/blur.c: removed randomize and repeat options;
|
||
made to run without popping a dialog. (bug #142318)
|
||
|
||
2004-06-16 Simon Budig <simon@gimp.org>
|
||
|
||
* modules/controller_linux_input.c: enable dial-events for
|
||
e.g. the powermate. Fixed typo.
|
||
|
||
2004-06-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* menus/image-menu.xml.in: added missing menu entries (bug #144449).
|
||
|
||
2004-06-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcontroller.[ch]: added
|
||
GimpController::get_event_blurb() which returns the strings that
|
||
were returned by get_event_name(). The latter returns
|
||
untranslatable event identifiers now.
|
||
|
||
* app/widgets/gimpcontrollerwheel.c
|
||
* modules/controller_linux_input.c: changed accordingly.
|
||
|
||
* app/widgets/gimpcontrollerinfo.c
|
||
* app/widgets/gimpcontrollers.c: changed the event mapping from
|
||
event-id -> action-name to event-name -> action-name.
|
||
|
||
* etc/controllerrc: changed accordingly (finally readable now).
|
||
|
||
2004-06-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpcontrollerinfo.[ch]: made an object out of
|
||
the GimpControllerInfo struct.
|
||
|
||
* app/widgets/gimpcontrollers.c: changed accordingly.
|
||
|
||
2004-06-16 Jakub Steiner <jimmac@ximian.com>
|
||
|
||
* etc/controllerrc: fix typo
|
||
|
||
2004-06-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* modules/controller_linux_input.c
|
||
* etc/controllerrc: preliminary wheel event support.
|
||
|
||
2004-06-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontrollers.c: better debugging output.
|
||
|
||
2004-06-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpcontrollers.c: bug fix.
|
||
|
||
* configure.in: check for linux/input.h.
|
||
|
||
* modules/Makefile.am
|
||
* modules/controller_linux_input.c: added a prototype controller
|
||
module using the linux input event interface.
|
||
|
||
* etc/controllerrc: added example config for linux input device.
|
||
|
||
2004-06-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontrollers.c: load the controller's
|
||
properties from the controllerrc file.
|
||
|
||
* etc/controllerrc: set the wheel's properties.
|
||
|
||
2004-06-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* etc/controllerrc: use the 10% actions for opacity.
|
||
|
||
2004-06-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontrollers.c: ref the actions when putting
|
||
them in the mapping table.
|
||
|
||
* app/actions/context-actions.c: added actions to change the
|
||
opacity in 10% steps.
|
||
|
||
2004-06-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcontroller.[ch]: added a "name" property.
|
||
Dispatch events only if the controller is enabled.
|
||
|
||
* app/widgets/gimpcontrollerwheel.c: added controller events for
|
||
all possible modifier combinations.
|
||
|
||
* etc/Makefile.am
|
||
* etc/controllerrc: default controllerrc which maps all unused
|
||
wheel+modifier combinations to more-or-less usefull stuff.
|
||
|
||
2004-06-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
Started to fix bug #106920 in a more genreral way:
|
||
|
||
* libgimpwidgets/Makefile.am
|
||
* libgimpwidgets/gimpwidgetstypes.h
|
||
* libgimpwidgets/gimpwidgetsmarshal.list
|
||
* libgimpwidgets/gimpcontroller.[ch]: new abstract base class
|
||
which provides an API for pluggable input controller modules
|
||
(mouse wheel, usb/midi stuff etc.).
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpcontrollerwheel.[ch]: subclass of the above
|
||
which maps wheel mouse scroll events to controller events.
|
||
|
||
* app/widgets/gimpcontrollers.[ch]: manager for controllers.
|
||
reads $(gimpdir)/controllerrc and keeps a mapping of controller
|
||
events to GtkActions.
|
||
|
||
* app/gui/gui.c: initialize and shut down the controller stuff.
|
||
|
||
* app/display/gimpdisplayshell-callbacks.c
|
||
(gimp_display_shell_canvas_tool_events): if a wheel controller
|
||
exists, dispatch GdkEventScroll to it first and return if it was
|
||
handled.
|
||
|
||
2004-06-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/text_tool.pdb: deprecate the XLFD-based API
|
||
gimp_text() and gimp_text_get_extents().
|
||
|
||
* app/pdb/text_tool_cmds.c
|
||
* libgimp/gimptexttool_pdb.[ch]: regenerated.
|
||
|
||
2004-06-15 Manish Singh <yosh@gimp.org>
|
||
|
||
* tools/pdbgen/pdbgen.pl
|
||
* tools/pdbgen/lib.pl: some simplistic code to add a $deprecated
|
||
flag to pdb definitions, which translates into GIMP_DISABLE_DEPRECATED
|
||
guards in lib headers.
|
||
|
||
2004-06-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/Makefile.am
|
||
* app/actions/context-actions.[ch]
|
||
* app/actions/context-commands.[ch]: added new action group to
|
||
modify all GimpContext properties. So far there are actions to
|
||
cycle through the lists of brushes, patterns etc., to change the
|
||
opacity, to swap and default colors and to edit generated brushes.
|
||
|
||
* app/actions/actions.c: register the new "context" action group.
|
||
|
||
* app/actions/tools-actions.c
|
||
* app/actions/tools-commands.[ch]: removed "tools-default-colors"
|
||
and "tools-swap-colors" actions and callbacks because they are
|
||
in the "context" action group now.
|
||
|
||
* app/menus/menus.c: add the "context" group to the <Image> and
|
||
<Dock> UI managers.
|
||
|
||
* menus/image-menu.xml.in: changed accordingly. Added a temporary
|
||
"Context" menu to test and debug the new actions.
|
||
|
||
2004-06-15 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/tools/gimpcroptool.c (crop_selection_callback): Force
|
||
aspect ratio to match selection when 'From Selection' is clicked.
|
||
Fixes bug #144361. Also converted tabs to spaces.
|
||
|
||
2004-06-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/mng.c (respin_cmap): applied the fix for empty
|
||
colormaps (bug #143009) here as well.
|
||
|
||
2004-06-15 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/core/gimpdrawable-transform.c
|
||
(gimp_drawable_transform_tiles_affine): Don't round texture
|
||
coordinates when not using interpolation. Fixes bug #144352 for
|
||
the nearest neighbor case only.
|
||
|
||
2004-06-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/paint/gimpinkoptions.c: replaced some arbitrary values with
|
||
larger but still arbitrary values (default and limit for ink size).
|
||
|
||
2004-06-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint/gimppaintcore.[ch]: removed PRETRACE_PAINT and
|
||
POSTTRACE_PAINT from the GimpPaintCoreState enum. Removed
|
||
"gboolean traces_on_window" from GimpPaintCoreClass.
|
||
|
||
* app/paint/gimpclone.[ch]
|
||
* app/paint/gimpink.c
|
||
* app/tools/gimpclonetool.c: changed accordingly.
|
||
|
||
* app/tools/gimppainttool.c: ditto. Show the brush outline
|
||
while painting. Fixes bug #118348.
|
||
|
||
2004-06-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimptransformtool.c: use gimp_draw_tool_is_active()
|
||
instead of GIMP_IS_DISPLAY(draw_tool->gdisp).
|
||
|
||
2004-06-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpactiongroup.c (gimp_action_group_add_*_actions):
|
||
do the workaround for "" accelerators only if the GTK+ version
|
||
is smaller than 2.4.3. Fixes bug #144342 for GTK+ >= 2.4.3.
|
||
|
||
2004-06-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpdrawable-transform.c: declared
|
||
gimp_drawable_transform_cubic() as inline function. Makes
|
||
sample_cubic() run about 10% faster and causes a 7% speedup on
|
||
cubic transformations.
|
||
|
||
* app/paint-funcs/paint-funcs.c (border_region): avoid an
|
||
unnecessary memory allocation.
|
||
|
||
2004-06-14 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/tools/gimptransformtool.c: Disable preview in corrective
|
||
mode, and notify preview when switching transform type and
|
||
direction.
|
||
|
||
2004-06-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint/gimppaintcore.[ch]: added new virtual function
|
||
GimpPaintCore::post_paint() and call it after calling
|
||
GimpPaintCore::paint().
|
||
|
||
* app/paint/gimpbrushcore.[ch]: renamed brush_core->grr_brush
|
||
to brush_core->main_brush and reset brush_core->brush
|
||
to brush_core->main_brush in GimpPaintCore::post_paint().
|
||
|
||
* app/paint/gimpbrushcore.c
|
||
* app/paint/gimppaintcore-stroke.c
|
||
* app/tools/gimppainttool.c: removed all code which restores
|
||
the brush_core's old brush after painting since post_paint()
|
||
does this automatically now.
|
||
|
||
* app/paint/gimpclone.[ch]: moved static variables to the
|
||
GimpClone struct.
|
||
|
||
2004-06-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/paint-funcs/paint-funcs-generic.h (color_pixels): some code
|
||
cleanup I did while attempting to optimize this code further.
|
||
|
||
2004-06-14 Henrik Brix Andersen <brix@gimp.org>
|
||
|
||
* app/plug-in/plug-in-run.c: let extensions run synchronously when
|
||
called via PDB. Fixes bug #140112.
|
||
|
||
2004-06-14 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/tools/gimptransformtool.c: Preview is now only used for
|
||
layer transformations.
|
||
|
||
2004-06-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimpperspectivetool.c
|
||
* app/tools/gimprotatetool.c
|
||
* app/tools/gimpscaletool.c
|
||
* app/tools/gimpsheartool.c: removed calls to
|
||
gimp_transform_tool_expose_preview() from all
|
||
GimpTransformTool::motion() implementations...
|
||
|
||
* app/tools/gimptransformtool.c: ...and call it after calling
|
||
tr_tool_class->preview().
|
||
|
||
2004-06-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell.[ch]: remember the last used
|
||
GimpCursorFormat so changing the format in prefs applies
|
||
instantly, and not after the next tool change.
|
||
|
||
* app/display/gimpdisplayshell-cursor.[ch]
|
||
* app/tools/gimptool.[ch]
|
||
* app/tools/gimptoolcontrol.[ch]
|
||
* app/tools/gimpclonetool.c
|
||
* app/tools/gimpcolortool.c
|
||
* app/tools/gimpcroptool.c
|
||
* app/tools/gimpcurvestool.c
|
||
* app/tools/gimpiscissorstool.c
|
||
* app/tools/gimpmeasuretool.c
|
||
* app/tools/gimpmovetool.c
|
||
* app/tools/gimptransformtool.c: s/GdkCursorType/GimpCursorType/g
|
||
|
||
2004-06-14 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/tools/gimptransformtool.c (gimp_transform_tool_doit): Preview
|
||
wasn't being turned off before performing a transformation. Also
|
||
converted tabs to spaces.
|
||
|
||
2004-06-14 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/display/gimpdisplayshell-preview.c: Transformation previews now
|
||
use the selection mask if it is present.
|
||
|
||
2004-06-13 Manish Singh <yosh@gimp.org>
|
||
|
||
* configure.in: Make sure PangoFT2 is using a recent enough fontconfig
|
||
since many people have broken and confused setups.
|
||
|
||
2004-06-13 Manish Singh <yosh@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/gradient_edit.pdb: cleans ups so generated
|
||
output doesn't warn about uninitialize variable use, and whitespace
|
||
cosmetic cleanups.
|
||
|
||
* app/pdb/gradient_edit_cmds.c: regenerated.
|
||
|
||
2004-06-13 Manish Singh <yosh@gimp.org>
|
||
|
||
* app/base/cpu-accel.c: Reorged, to address bug #142907 and
|
||
bug #143069. Accel implementations #define HAVE_ACCEL, and cpu_accel()
|
||
keys on that. Both PPC and X86 implementations check for __GNUC__.
|
||
X86 stuff is only used with USE_MMX is defined. The SSE OS check
|
||
is now checked in arch_accel(), not cpu_accel(). Finally, the
|
||
arch x86_64 checks now are EM64T aware (which didn't matter in
|
||
practice).
|
||
|
||
2004-06-13 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/display/gimpdisplayshell-preview.c: use drawable_mask_bounds()
|
||
for texture coordinates instead of the drawable's width and height.
|
||
|
||
2004-06-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/paint-funcs/paint-funcs.c (shapeburst_region): don't call
|
||
tile_ewidth() three times from the inner loop.
|
||
|
||
* app/base/tile-manager.c (tile_manager_get): don't call
|
||
tile_size() twice on the same tile.
|
||
|
||
* app/base/tile-private.h: added tile_size_inline(), an inline
|
||
version of the tile_size() function.
|
||
|
||
* app/base/tile-cache.c
|
||
* app/base/tile-manager.c
|
||
* app/base/tile-swap.c
|
||
* app/base/tile.c: use tile_size_inline() from inside the tile
|
||
subsystem.
|
||
|
||
2004-06-13 Simon Budig <simon@gimp.org>
|
||
|
||
* app/tools/gimpiscissorstool.c: Minor tweaks to two macros.
|
||
Shouldn't change anything.
|
||
|
||
2004-06-13 Jakub Steiner <jimmac@ximian.com>
|
||
|
||
* cursors/tool-zoom.png:
|
||
* cursors/cursor-zoom.png: minor fsckup
|
||
|
||
2004-06-13 Jakub Steiner <jimmac@ximian.com>
|
||
|
||
* cursors/gimp-tool-cursors.xcf
|
||
* cursors/tool-burn.png: the burn tool doesn't really have an
|
||
inverted handle
|
||
|
||
2004-06-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/paint-funcs/paint-funcs.[ch] (shapeburst_region): added
|
||
progress callback.
|
||
|
||
* app/core/gimpdrawable-blend.c: show a progress while calculating
|
||
the Shapeburst. Not perfect but better than not showing any
|
||
progress at all.
|
||
|
||
2004-06-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/widgets-enums.[ch]: added enum GimpCursorFormat
|
||
which can be one of { BITMAP, PIXBUF, PIXBUF-PREMULTIPLY } to
|
||
work around broken X servers.
|
||
|
||
* app/config/gimpguiconfig.[ch]
|
||
* app/config/gimprc-blurbs.h: added GimpGuiConfig::cursor-format.
|
||
|
||
* app/gui/preferences-dialog.c: added a GUI for the new option.
|
||
|
||
* app/widgets/gimpcursor.[ch]: added cursor_format parameter
|
||
to gimp_cursor_new() and _set().
|
||
|
||
* app/display/gimpdisplayshell-cursor.c
|
||
* app/tools/gimpcurvestool.c
|
||
* app/widgets/gimpdialogfactory.c: pass an appropriate cursor_mode.
|
||
|
||
2004-06-12 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/core/gimpdrawable-blend.c: added missing semicolon.
|
||
|
||
2004-06-12 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/display/gimpdisplayshell-callbacks.c: Fixed incorrect logic that
|
||
caused perfect-but-slow pointer tracking to be used in tools that
|
||
don't request exact mode.
|
||
|
||
* app/display/Makefile.am:
|
||
* app/display/gimpdisplayshell-appearance.[ch]:
|
||
* app/display/gimpdisplayshell-callbacks.c:
|
||
* app/display/gimpdisplayshell.[ch]:
|
||
* app/display/gimpdisplayshell-preview.[ch]: added
|
||
* app/tools/gimpperspectivetool.c:
|
||
* app/tools/gimprotatetool.c:
|
||
* app/tools/gimpscaletool.c:
|
||
* app/tools/gimpsheartool.c:
|
||
* app/tools/gimptransformoptions.[ch]:
|
||
* app/tools/gimptransformtool.[ch]: Implemented live transformation
|
||
previews, available through tool options. Fixes bug #108172.
|
||
|
||
2004-06-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpdrawable-blend.c (gradient_render_pixel): inline
|
||
the repeat functions.
|
||
|
||
* app/core/gimpgradient.c: inline the curve functions.
|
||
|
||
2004-06-13 Jakub Steiner <jimmac@ximian.com>
|
||
|
||
* cursors/gimp-tool-cursors.xcf
|
||
* cursors/tool-zoom.png: make more transparent
|
||
|
||
2004-06-13 Jakub Steiner <jimmac@ximian.com>
|
||
|
||
* cursors/gimp-tool-cursors.xcf
|
||
* cursors/tool-blur.png
|
||
* cursors/tool-bucket-fill.png
|
||
* cursors/tool-dodge.png
|
||
* cursors/tool-eraser.png
|
||
* cursors/tool-hand.png: fix a few problems hidden by low opacity
|
||
|
||
2004-06-13 Jakub Steiner <jimmac@ximian.com>
|
||
|
||
* cursor/*png: updated the cursors
|
||
|
||
2004-06-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
* cursors/gimp-tool-cursors.xcf: added nice new antialiased
|
||
cursor layers made by Jimmac.
|
||
|
||
2004-06-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimppalette.c (gimp_palette_load): don't use the rather
|
||
inefficient gimp_palette_add_entry() when loading a palette.
|
||
|
||
2004-06-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpdata.[ch]: added "gint freeze_count" and
|
||
gimp_data_freeze()/thaw() functions. Emit "dirty" only if
|
||
freeze_count either is 0 or drops to 0.
|
||
|
||
* app/core/gimpbrushgenerated.[ch]
|
||
* app/core/gimpgradient.[ch]: removed freeze/thaw stuff that
|
||
was duplicated in these two subclasses and use the new
|
||
GimpData API instead.
|
||
|
||
* app/widgets/gimpbrusheditor.c
|
||
* app/widgets/gimpgradienteditor.c: changed accordingly.
|
||
|
||
2004-06-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpcolorbar.c (gimp_color_bar_expose): don't copy
|
||
the first row onto itself.
|
||
|
||
2004-06-12 Simon Budig <simon@gimp.org>
|
||
|
||
* app/tools/gimptransformtool.c: Make Enter/Return apply the
|
||
transformation, Backspace/Delete resets the transformation.
|
||
|
||
* app/tools/gimpcroptool.c: Simplify the key_press callback.
|
||
|
||
2004-06-12 Simon Budig <simon@gimp.org>
|
||
|
||
* app/tools/gimpcroptool.c: Make the Enter/Return key do
|
||
the crop action.
|
||
|
||
* app/tools/gimpeditselectiontool.c
|
||
* app/tools/gimpvectortool.c: Make the _key_press functions
|
||
safe for non-arrow keys.
|
||
|
||
2004-06-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/composite/gimp-composite.[ch]: just some cleanup.
|
||
|
||
2004-06-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-callbacks.c
|
||
(gimp_display_shell_events): ported some forgotten #if 0'ed
|
||
GtkItemFactory stuff to GtkUIManager.
|
||
|
||
2004-06-12 Simon Budig <simon@gimp.org>
|
||
|
||
* app/tools/gimptool.[ch]: renamed the "arrow_key" member
|
||
to "key_press", since it is now no longer about just the arrow
|
||
keys.
|
||
|
||
* app/tools/gimpcroptool.c
|
||
* app/tools/gimpeditselectiontool.c
|
||
* app/tools/gimpeditselectiontool.h
|
||
* app/tools/gimpmovetool.c
|
||
* app/tools/gimppainttool.c
|
||
* app/tools/gimpselectiontool.c
|
||
* app/tools/gimptexttool.c
|
||
* app/tools/gimpvectortool.c
|
||
* app/tools/tool_manager.c: Changed accordingly.
|
||
|
||
2004-06-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell.c (gimp_display_shell_init): add
|
||
the file DND destination before all others so the DND code will
|
||
implicitly use its destination properties. Works around Konqueror
|
||
offering only file MOVE, not COPY and fixes bug #144168.
|
||
|
||
2004-06-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/sample_colorize.c: reindented, some minor cleanup.
|
||
|
||
2004-06-12 Simon Budig <simon@gimp.org>
|
||
|
||
* app/tools/tool_manager.[ch]: renamed
|
||
tool_manager_arrow_key_active to tool_manager_key_press_active.
|
||
|
||
* app/display/gimpdisplayshell-callbacks.c: Also dispatch
|
||
GDK_Return/KP_Enter/BackSpace/Delete to the tools, the
|
||
"arrow_key" member of GimpTool probably should be renamed.
|
||
|
||
* app/tools/gimpvectortool.c: Use Enter/Return to convert the
|
||
current path to a selection, use Backspace/Delete to delete the
|
||
currently active anchors in a path.
|
||
|
||
Implemented on Jimmacs request - thanks to him and Iva for being
|
||
a great host :)
|
||
|
||
2004-06-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimphistogrameditor.c (gimp_histogram_editor_init):
|
||
set the initially selected channel on the histogram combobox.
|
||
Fixes bug #144225.
|
||
|
||
2004-06-12 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/paint/gimppaintoptions.[ch]: renamed all "pressure-pressure"
|
||
variables to "pressure-hardness".
|
||
|
||
* app/paint/gimpairbrush.c:
|
||
* app/tools/gimppaintoptions-gui.c: changed accordingly.
|
||
|
||
2004-06-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimpcolorarea.c: replaced destroy() by
|
||
finalize(), converted tabs to spaces, cleanup.
|
||
|
||
2004-06-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpthumbbox.c (gimp_thumb_box_new): line-wrap the
|
||
filename label if it's too long instead of cutting it off.
|
||
|
||
2004-06-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/widgets-enums.h (enum GimpCursorModifier):
|
||
s/GIMP_LAST_CURSOR_MODIFIER_ENTRY/GIMP_CURSOR_MODIFIER_LAST/.
|
||
|
||
* app/widgets/gimpcursor.c: changed accordingly. Renamed struct
|
||
GimpBitmapCursor to GimpCursor. More cleanup.
|
||
|
||
2004-06-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/image-actions.c
|
||
* app/actions/image-commands.[ch]
|
||
* app/actions/layers-actions.c
|
||
* app/actions/layers-commands.[ch]: made the
|
||
"image-convert-rgb/grayscale/indexed" and the
|
||
"layers-mask-apply/delete" actions GimpEnumActions and merged
|
||
their callbacks.
|
||
|
||
2004-06-10 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/gui/preferences-dialog.c: restored the 'Show Paint Tool
|
||
Cursor' option that was removed during clean-up.
|
||
|
||
2004-06-10 Philip Lafleur <plafleur@cvs.gnome.org>
|
||
|
||
* app/paint/gimpbrushcore.c (gimp_brush_core_pressurize_mask):
|
||
avoided some redundant calculations.
|
||
|
||
2004-06-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/user-install-dialog.c: removed the monitor calibration
|
||
from the user installation process. It's not a vital setting and
|
||
can be done from the Preferences dialog later.
|
||
|
||
* app/gui/resolution-calibrate-dialog.[ch]: simplified the
|
||
resolution calibration dialog by removing the hacks that were
|
||
needed for drawing it in the user-installation style.
|
||
|
||
* app/gui/preferences-dialog.c: changed accordingly. Also removed
|
||
the separator from the Display page.
|
||
|
||
2004-06-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimptemplateeditor.[ch]: added an API to
|
||
expand/collapse the "Advanced Options" frame.
|
||
|
||
* app/gui/preferences-dialog.c
|
||
* app/widgets/gimphelp-ids.h: applied a patch done by William
|
||
Skaggs that cleans up and reorganizes the Preferences dialog
|
||
(bug #144060).
|
||
|
||
2004-06-09 Simon Budig <simon@gimp.org>
|
||
|
||
* app/core/gimpcoords.[ch]: renamed gimp_coords_length2 to
|
||
gimp_coords_length_squared.
|
||
|
||
* app/vectors/gimpbezierstroke.c: Changed accordingly
|
||
|
||
2004-06-09 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimppenciltool.c (gimp_pencil_tool_init): no need to
|
||
request GIMP_MOTION_MODE_EXACT here since the parent class does
|
||
that already.
|
||
|
||
* app/tools/gimpinktool.c (gimp_ink_tool_init): ditto. Enable the
|
||
color picker feature for the ink tool.
|
||
|
||
2004-06-09 Sven Neumann <sven@gimp.org>
|
||
|
||
* menus/image-menu.xml.in: added "Selection Editor" to the
|
||
Selection menu. Still hoping for the great menu reorganization
|
||
though...
|
||
|
||
* app/actions/select-actions.c (select_actions_update): "Save to
|
||
Channel" makes sense without a selection also, so don't set it
|
||
insensitive.
|
||
|
||
2004-06-07 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/glob.c: the glob(3) function is not available on
|
||
Win32 and also isn't necessarily UTF-8 safe. Started to add an
|
||
alternative implementation. Right now there's just some code taken
|
||
from GTK+ (an UTF-8 save fnmatch() implementation) and the plug-in
|
||
does nothing useful. I will add some stripped-down glob code based
|
||
on the code in glibc later.
|
||
|
||
2004-06-07 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimplayer.c (gimp_layer_set_tiles): don't set
|
||
layer->mask's offsets. It is wrong because GimpDrawable::set_tiles()
|
||
is a lowlevel function which is used by stuff like scale and
|
||
resize which keep the mask in sync explicitely and don't expect it
|
||
to be moved in the middle of chaining up. Fixes bug #143860.
|
||
|
||
2004-06-07 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/view-actions.c
|
||
* app/actions/view-commands.[ch]: added separate callback for
|
||
"view-zoom-other" and connect GtkAction::activate manually so
|
||
"Other..." can be selected even if it's the active item in the
|
||
zoom radio group. Fixes bug #143850.
|
||
|
||
2004-06-07 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/tileit.c (tileit_dialog): fixed a typo.
|
||
|
||
2004-06-07 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/menus/plug-in-menus.c (plug_in_menus_setup): sort the menus
|
||
by the translated menu path stripped from underscores.
|
||
|
||
2004-06-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/gauss.c (gauss): fixed a stupid cut'n'paste bug
|
||
I introduced yesterday.
|
||
|
||
2004-06-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/gauss.c (query): register the menu entry the new
|
||
way and install a mnemonic for Gaussian Blur.
|
||
|
||
2004-06-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/curve_bend.c: applied a patch from Henrik Brix
|
||
Andersen that tells the user that Curve Bend cannot operate on
|
||
layers with masks instead of silently applying the mask
|
||
(bug #134748).
|
||
|
||
2004-06-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/plugin-defs.pl
|
||
* plug-ins/common/Makefile.am
|
||
* plug-ins/common/gauss_iir.c
|
||
* plug-ins/common/gauss_rle.c: removed the two gaussian blur
|
||
plug-ins...
|
||
|
||
* plug-ins/common/gauss.c: and added a merged version done by
|
||
William Skaggs. Fixes bug #134088.
|
||
|
||
2004-06-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/sgi/sgi.c: applied a patch from Philip Lafleur that
|
||
makes the plug-in handle images with more than 4 channels. At the
|
||
moment the extra information is discarded (bug #143673).
|
||
|
||
2004-06-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/unsharp.c: applied a modified patch from Geert
|
||
Jordaens that adds a preview to the Unsharp Mask plug-in. Fixes
|
||
bug #140974.
|
||
|
||
2004-06-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/paint/gimppaintcore.c
|
||
* app/paint-funcs/paint-funcs-generic.h
|
||
* app/paint-funcs/paint-funcs.[ch]: applied a patch from Philip
|
||
Lafleur that changes the way that paint is applied during a paint
|
||
stroke. Fixes bug #124225.
|
||
|
||
2004-06-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/Makefile.am
|
||
* plug-ins/common/plugin-defs.pl
|
||
* plug-ins/common/glob.c: added a simple glob plug-in based on
|
||
some old code by George Hartz. This plug-in is very useful when
|
||
you need to do batch processing, especially from Script-Fu.
|
||
Fixes bug #143661.
|
||
|
||
2004-06-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpgradienteditor.c: applied a patch from David
|
||
Gowers that makes the gradient editor display the perceptual
|
||
intensity of the color under the cursor (bug #135037).
|
||
|
||
2004-06-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/snoise.c: applied a modifed patch from Yeti that
|
||
adds a preview to the Solid Noise plug-in (bug #142587).
|
||
|
||
2004-06-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/tiff.c: save the proper value for type of alpha
|
||
channel. Fixes bug #143522; patch by Philip Lafleur.
|
||
|
||
2004-06-05 Manish Singh <yosh@gimp.org>
|
||
|
||
* app/gui/preferences-dialog.c (prefs_dialog_new): update call
|
||
to prefs_spin_button_add for num-processors too.
|
||
|
||
2004-06-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-scripts.c (script_fu_interface):
|
||
left align toggle buttons.
|
||
|
||
2004-06-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/text/gimptextlayer-transform.[ch]: updated the (still unused)
|
||
text transformation code.
|
||
|
||
* app/text/gimptext-bitmap.c: removed a redundant transformation.
|
||
|
||
2004-06-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* cursors/Makefile.am
|
||
* cursors/cursor-none.png
|
||
* cursors/xbm/cursor-none.xbm: new empty cursor images.
|
||
|
||
* app/config/gimpdisplayconfig.[ch]
|
||
* app/config/gimprc-blurbs.h
|
||
* app/widgets/widgets-enums.h
|
||
* app/widgets/gimpcursor.c
|
||
* app/display/gimpdisplayshell-cursor.c
|
||
* app/tools/gimppainttool.[ch]
|
||
* app/tools/gimpinktool.c
|
||
* app/gui/preferences-dialog.c: applied patches from Philip
|
||
Lafleur which implement hiding the cursor completely for paint
|
||
tools. Changed the name of the config option from
|
||
"hide-paint-tool-cursor" to "show-paint-tool-cursor" and default
|
||
to TRUE because this needs the brush outline being visible while
|
||
painting to be really usable. Fixes bug #132163.
|
||
|
||
* app/widgets/widgets-enums.h: renamed all GimpCursorType and
|
||
GimpToolCursorType enum values to GIMP_CURSOR_* and
|
||
GIMP_TOOL_CURSOR_*.
|
||
|
||
* app/widgets/gimpcursor.c
|
||
* app/display/gimpdisplayshell-callbacks.c
|
||
* app/display/gimpdisplayshell-cursor.c
|
||
* app/tools/gimp*tool.c; changed accordingly.
|
||
|
||
2004-06-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcursor.c: changed create_cursor_foo() utility
|
||
functions to get_cursor_foo() and use them as accessors instead of
|
||
using cursor->member. Use gdk_pixbuf_copy() instead of compositing
|
||
the initial image onto an empty pixbuf.
|
||
|
||
2004-06-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimptexteditor.c (gimp_text_editor_new): set the
|
||
focus on the text area.
|
||
|
||
2004-06-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimptexttool.c (gimp_text_tool_class_init): allow to
|
||
move a text layer using the cursor keys.
|
||
|
||
2004-06-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* cursors/*.xbm: removed...
|
||
|
||
* cursors/xbm/*.xbm: ...and added here instead. Renamed them
|
||
all to match the PNG file names.
|
||
|
||
* cursors/Makefile.am: changed accordingly.
|
||
|
||
* app/widget/gimpcursor.c: ditto. Merged the two cursor creating
|
||
functions again because they duplicated too much code.
|
||
|
||
2004-06-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/menus/plug-in-menus.c (plug_in_menus_setup): populate the
|
||
tree with collation keys and use strcmp() instead of
|
||
g_utf8_collate() as the tree's sort function.
|
||
|
||
2004-06-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/paint/gimppaintoptions.c (DEFAULT_PRESSURE_PRESSURE):
|
||
applied a patch by Philip Lafleur that changes the default to
|
||
FALSE. Fixes bug #143626.
|
||
|
||
2004-06-03 Michael Natterer <mitch@gimpmp.org>
|
||
|
||
* app/widgets/gimptoolbox.c (gimp_toolbox_size_allocate): use
|
||
gtk_widget_size_request() instead of _get_child_requisition()
|
||
because we need to know the size of the toolbox' areas
|
||
even if they are invisible. Fixes SIGFPE spotted by Jimmac.
|
||
|
||
2004-06-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcursor.c: some cleanup. Make the tool_cursor
|
||
and cursor_modifier components slightly transparent.
|
||
|
||
* cursors/cursor-mouse.png: was the wrong image.
|
||
|
||
2004-06-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* cursors/Makefile.am
|
||
* cursors/*.png: added PNG version of all cursors.
|
||
|
||
* cursors/gimp-tool-cursors.xcf: reordered and renamed all layers
|
||
to match the new PNG filenames.
|
||
|
||
* app/widgets/gimpcursor.[ch]: create cursors with alpha and color
|
||
if the GdkDisplay supports it. Fall back to the old stuff
|
||
otherwise.
|
||
|
||
2004-06-03 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimppattern.c (gimp_pattern_load_pixbuf): if a Title is
|
||
set, use that as the pattern name.
|
||
|
||
2004-06-03 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpdatafactory.c (gimp_data_factory_load_data):
|
||
removed commented-out message.
|
||
|
||
* app/core/gimppattern.[ch]: fixed handling of errors and PNG
|
||
comments in new pattern loader. Renamed functions for consistency
|
||
with other data loaders.
|
||
|
||
* app/core/gimp.c: changed accordingly.
|
||
|
||
2004-06-03 Dave Neary <bolsh@gimp.org>
|
||
|
||
* app/core/gimp.c:
|
||
* app/core/gimpdatafactory.c:
|
||
* app/core/gimppattern.[ch]: Add support for GdkPixbuf patterns,
|
||
so now all of png, jpex, pnm, xbm, bmp, gif, ico, pcx, ras, tga,
|
||
xpm and tiff can be used for patterns.
|
||
|
||
2004-06-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/vectors-actions.c: added alternative actions
|
||
"vectors-selection-from-vectors" and
|
||
"vectors-selection-to-vectors-short" with different labels suited
|
||
for the "Select" menu.
|
||
|
||
* app/actions/select-actions.c: removed "select-from-vectors"
|
||
and "select-to-vectors" (to vectors was crashing anyway).
|
||
|
||
* app/actions/select-commands.[ch]: removed
|
||
select_from_vectors_cmd_callback(). Fixes code dupliction.
|
||
|
||
* menus/image-menu.xml.in
|
||
* menus/selection-editor-menu.xml: changed accordingly.
|
||
|
||
2004-06-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpgradienteditor.c (control_motion): use the newly
|
||
added GimpGradient API to set the segment's handles instead of
|
||
setting the values directly. Dirties the gradient correctly and
|
||
makes the preview update instantly again. Fixes bug #143605.
|
||
|
||
2004-06-03 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/file-open-location-dialog.c
|
||
(file_open_location_completion): check for NULL pointer before
|
||
passing it to g_utf8_normalize(). Just a workaround for a problem
|
||
in GimpContainerView.
|
||
|
||
2004-06-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* INSTALL: more updates.
|
||
|
||
2004-06-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* Made 2.1.0 development release.
|
||
|
||
2004-06-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-scale.c
|
||
* app/gui/info-window.c
|
||
* app/gui/preferences-dialog.c
|
||
* app/gui/resize-dialog.c
|
||
* app/tools/gimpcolorbalancetool.c
|
||
* app/tools/gimpcurvestool.c
|
||
* app/tools/gimphuesaturationtool.c
|
||
* app/tools/gimplevelstool.c
|
||
* app/tools/gimpthresholdtool.c
|
||
* app/widgets/gimpdockable.c
|
||
* app/widgets/gimpfiledialog.c
|
||
* app/widgets/gimpgradienteditor.c
|
||
* app/widgets/gimphistogrambox.c
|
||
* app/widgets/gimplayertreeview.c
|
||
* app/widgets/gimpstrokeeditor.c: tweaked some spacings for
|
||
consistency and better HIG compliance.
|
||
|
||
2004-06-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/gradient_edit.pdb: set_blending_function() and
|
||
set_coloring_type() work on segment ranges, renamed them
|
||
accordingly. Spotted by Shlomi Fish.
|
||
|
||
* app/pdb/gradient_edit_cmds.c
|
||
* libgimp/gimpgradientedit_pdb.[ch]: regenerated.
|
||
|
||
2004-06-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpdnd.[ch]: removed utility funtion
|
||
gimp_dnd_open_files().
|
||
|
||
* app/widgets/gimptoolbox-dnd.c: added gimp_toolbox_drop_files()
|
||
instead.
|
||
|
||
* app/display/gimpdisplayshell-dnd.c (gimp_display_shell_drop_files):
|
||
show the error message if opening a dropped file fails.
|
||
|
||
2004-06-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpthumb/gimpthumbnail.c: plugged a small memory leak.
|
||
|
||
2004-06-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpdnd.h: removed enum GimpDndType...
|
||
|
||
* app/widgets/widgets-enums.h: ...and added it here.
|
||
|
||
* app/widgets/gimpdnd.c: added more g_return_if_fail(). Allow
|
||
all gimp_dnd_foo_dest_add() functions to be called without
|
||
callback (just add the target if callback is NULL).
|
||
|
||
(gimp_dnd_open_files): removed the checks for validity of the
|
||
passed filenames/uris...
|
||
|
||
(gimp_dnd_set_file_data): ...and added it here so all callbacks
|
||
get an already sanitized list of strings.
|
||
|
||
2004-06-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/Makefile.am (EXTRA_DIST)
|
||
* app/menus/Makefile.am (EXTRA_DIST): removed makefile.msc until
|
||
they have been added.
|
||
|
||
2004-06-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpcontainerview.c: create the hash table when
|
||
inserting items; removes redundant create/destroy cycles and plugs
|
||
a memory leak.
|
||
|
||
2004-06-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* INSTALL: updated for gimp-2.1. Suggest to use gimp-print
|
||
version 4.2.7-pre1 in case of problems (see bug #138273).
|
||
|
||
2004-06-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-dnd.c
|
||
(gimp_display_shell_drop_files): copy the merged layer, not the
|
||
first one. Preserve the type of the layer to make e.g. dropping an
|
||
XCF with a single text layer work.
|
||
|
||
2004-06-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* NEWS
|
||
* README: updated.
|
||
|
||
2004-06-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell.c (gimp_display_shell_init): accept
|
||
file/uri drops.
|
||
|
||
* app/display/gimpdisplayshell-dnd.[ch]
|
||
(gimp_display_shell_drop_files): open any kind of image and turn
|
||
it into a single layer which is added to the image (suggested by
|
||
Antenne Springborn).
|
||
|
||
2004-06-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/gradient_edit.pdb
|
||
* tools/pdbgen/pdb/gradients.pdb: mark new API as new using $since.
|
||
|
||
* libgimp/gimpgradientedit_pdb.c
|
||
* libgimp/gimpgradients_pdb.c: regenerated.
|
||
|
||
2004-06-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/gradient_edit.pdb: forgot two more s/int32/enum/.
|
||
|
||
* app/pdb/gradient_edit_cmds.c
|
||
* libgimp/gimpgradientedit_pdb.[ch]: regenerated.
|
||
|
||
2004-06-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/image.pdb
|
||
* app/pdb/image_cmds.c
|
||
* app/core/gimpimage.[ch]: reverted changes I did to the image
|
||
unit earlier. As in 2.0, it will continue to not accept pixels.
|
||
This makes the PDB API and the XCF format compatible again and
|
||
fixes bug #142961 (and to some extent bug #137704).
|
||
|
||
* app/core/Makefile.am
|
||
* app/core/gimpimage-unit.[ch]: removed these files. The
|
||
convenience accessors defined here aren't commonly used any
|
||
longer.
|
||
|
||
* app/display/gimpdisplay.[ch]
|
||
* app/display/gimpdisplayshell.[ch]: added a unit parameter to
|
||
gimp_display_new(). Made "unit" and "scale" properties of
|
||
GimpDisplayShell.
|
||
|
||
* app/actions/image-commands.c
|
||
* app/actions/images-commands.c
|
||
* app/actions/layers-commands.c
|
||
* app/actions/select-commands.c
|
||
* app/actions/view-commands.c
|
||
* app/core/gimp-edit.c
|
||
* app/core/gimp.[ch]
|
||
* app/core/gimptemplate.c
|
||
* app/display/gimpdisplayshell-handlers.c
|
||
* app/display/gimpdisplayshell-scale.c
|
||
* app/display/gimpdisplayshell-title.c
|
||
* app/display/gimpstatusbar.c
|
||
* app/file/file-open.c
|
||
* app/gui/gui-vtable.c
|
||
* app/gui/info-window.c
|
||
* app/gui/offset-dialog.c
|
||
* app/gui/resize-dialog.[ch]
|
||
* app/pdb/display_cmds.c
|
||
* app/tools/gimpcroptool.c
|
||
* app/tools/gimpmeasuretool.c
|
||
* app/tools/gimppainttool.c
|
||
* app/tools/gimprectselecttool.c
|
||
* app/tools/gimprotatetool.c
|
||
* app/tools/gimpscaletool.c
|
||
* app/vectors/gimpvectors-export.c
|
||
* app/widgets/gimptoolbox-dnd.c
|
||
* tools/pdbgen/pdb/display.pdb: changed accordingly. Use the
|
||
display unit where the image unit was used before.
|
||
|
||
2004-06-01 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/gradient_edit.pdb: use enums instead of
|
||
integers, cleanup.
|
||
|
||
* app/pdb/gradient_edit_cmds.c
|
||
* libgimp/gimpgradientedit_pdb.[ch]: regenerated.
|
||
|
||
2004-06-01 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpdatafactory.[ch]: added new function
|
||
gimp_data_factory_data_delete().
|
||
|
||
* app/actions/data-commands.c (data_delete_callback): use it.
|
||
|
||
* tools/pdbgen/pdb/gradients.pdb: applied (slightly modified)
|
||
patch from Shlomi Fish which adds PDB wrappers to create, delete,
|
||
duplicate and rename gradients. Fixes bug #143528.
|
||
|
||
* app/pdb/gradients_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* libgimp/gimpgradients_pdb.[ch]: regenerated.
|
||
|
||
2004-06-01 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/core-enums.h: renamed the values of the
|
||
GimpGradientSegment* enums from GIMP_GRAD_* to
|
||
GIMP_GRADIENT_SEGMENT_* because they are exported now.
|
||
|
||
* app/core/gimp-gradients.c
|
||
* app/core/gimpgradient.c
|
||
* app/actions/gradient-editor-actions.c: changed accordingly.
|
||
|
||
* libgimp/gimpenums.h
|
||
* plug-ins/pygimp/gimpenums.py
|
||
* plug-ins/script-fu/script-fu-constants.c
|
||
* tools/pdbgen/enums.pl: regenerated.
|
||
|
||
2004-06-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/tiff.c: don't call gtk_entry_set_text() with a
|
||
NULL text.
|
||
|
||
2004-06-01 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontainertreeview-dnd.c
|
||
* app/widgets/gimpitemtreeview.c: some cleanup in the tree view
|
||
DND code.
|
||
|
||
2004-06-01 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpsessioninfo.c (gimp_session_info_restore): added
|
||
a horrible hack that sets the paned's position after the first
|
||
"size-allocate" after "map". Makes position remembering work for
|
||
the toolbox and fixes bug #142697.
|
||
|
||
* app/widgets/gimpdockable.[ch]: added new function
|
||
gimp_dockable_set_tab_style()
|
||
|
||
* app/actions/dockable-commands.c (dockable_tab_style_cmd_callback)
|
||
* app/widgets/gimpsessioninfo.c (gimp_session_info_restore):
|
||
use gimp_dockable_set_tab_style().
|
||
|
||
2004-06-01 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimptoolbox.c (toolbox_area_notify): removed
|
||
unused variable.
|
||
|
||
2004-06-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/autocrop.c (query): register as "Autocrop Image"
|
||
and "Autocrop Layer".
|
||
|
||
2004-06-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/image-commands.c (image_new_cmd_callback):
|
||
initialize the dialog by calling file_new_dialog_set(). Fixes bug
|
||
#143477.
|
||
|
||
2004-05-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpcontainerentry.[ch]: export the column enum.
|
||
|
||
* app/gui/file-open-location-dialog.c: use a GimpContainerEntry
|
||
on the documents list. Use a custom match function that matches
|
||
without the leading protocol part.
|
||
|
||
2004-05-31 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/gimptoolbox-image-area.[ch]: new toolbox area which
|
||
shows the active image.
|
||
|
||
* app/config/gimpguiconfig.[ch]
|
||
* app/config/gimprc-blurbs.h: added config options to control the
|
||
visibility of the toolbox' color, indicator and image areas.
|
||
|
||
* app/widgets/gimptoolbox.[ch]: added the image area and honor the
|
||
new config options. Put the various areas into their own wrap box.
|
||
|
||
* app/widgets/gimptoolbox-dnd.c: changed accordingly.
|
||
|
||
* app/widgets/gimphelp-ids.h: added a help ID for the image area.
|
||
|
||
* app/widgets/gimptoolbox-indicator-area.c: made the previews
|
||
a bit larger, cleanup.
|
||
|
||
* app/gui/preferences-dialog.c: added a "Toolbox" page as GUI for
|
||
the new config options.
|
||
|
||
* themes/Default/images/preferences/Makefile.am
|
||
* themes/Default/images/preferences/toolbox.png: a (wrong) icon
|
||
for the "Toolbox" prefs page. Needs to be replaced.
|
||
|
||
2004-05-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpcontainerentry.[ch]: added new widget
|
||
GimpContainerEntry, a GtkEntry with completion that implements the
|
||
GimpContainerView interface.
|
||
|
||
* app/tools/gimptextoptions.c (gimp_text_options_gui): added a
|
||
GimpContainerEntry to select the font.
|
||
|
||
2004-05-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/Makefile.am
|
||
* app/actions/file-actions.c
|
||
* app/actions/file-commands.[ch]
|
||
* app/gui/Makefile.am
|
||
* app/gui/file-open-location-dialog.[ch]
|
||
* app/widgets/gimphelp-ids.h
|
||
* menus/image-menu.xml.in
|
||
* menus/toolbox-menu.xml.in: added a rudimentary "Open Location"
|
||
dialog.
|
||
|
||
2004-05-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/mblur.c (mblur_zoom): push pixels outwards not
|
||
to the center as suggested by Chad Daelhousen (bug #142968).
|
||
|
||
2004-05-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/mblur.c: applied patch from William Skaggs that
|
||
adds the possibility to choose the center of radial and zoom
|
||
motion blurs (bug #113711).
|
||
|
||
2004-05-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/paint/gimpconvolve.c
|
||
* app/paint-funcs/paint-funcs.[ch]
|
||
* app/tools/gimpiscissorstool.c: reverted last change and applied
|
||
new patch instead (bug #72878).
|
||
|
||
2004-05-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/paint/gimpconvolve.c
|
||
* app/paint-funcs/paint-funcs.[ch]
|
||
* app/tools/gimpiscissorstool.c: applied a patch from Philip
|
||
Lafleur that fixes RGBA resampling in Convolve tool (bug #72878).
|
||
|
||
2004-05-31 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/imagemap/imap_cmd_gimp_guides.c
|
||
* plug-ins/imagemap/imap_edit_area_info.c
|
||
* plug-ins/imagemap/imap_preferences.c
|
||
* plug-ins/imagemap/imap_settings.c: need to include gimpwidgets.h.
|
||
|
||
2004-05-31 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/core-enums.h
|
||
* app/core/gimpgradient.[ch]
|
||
* app/pdb/Makefile.am
|
||
* app/widgets/gimpgradienteditor.c
|
||
* tools/pdbgen/Makefile.am
|
||
* tools/pdbgen/groups.pl
|
||
* tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi
|
||
Fish that adds lots of gradient edit functions to
|
||
gimpgradient.[ch] and makes them available through the PDB.
|
||
Fixes bug #129675 and bug #129678.
|
||
|
||
Did some cleanups / enhancments to the patch:
|
||
|
||
* app/core/gimpgradient.[ch]: changed the naming scheme of the new
|
||
functions and changed old functions to match the new scheme.
|
||
Introduce a "freeze_count" and public freeze()/thaw() API which
|
||
enables subsequent gradient changes without "dirty" being emitted
|
||
all the time. Added GimpGradient parameters to all functions
|
||
which modify the gradient.
|
||
|
||
* app/widgets/gimpgradienteditor.c: use the new freeze/thaw
|
||
stuff to keep the gradient from updating when not in
|
||
"Instant Update" mode.
|
||
|
||
* app/actions/gradient-editor-commands.c: removed all gradient
|
||
editing code and call the new core functions.
|
||
|
||
* libgimp/Makefile.am
|
||
* tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all
|
||
added functions. Generate libgimp wrappers for them..
|
||
|
||
* app/pdb/gradient_edit_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* libgimp/gimp_pdb.h
|
||
* libgimp/gimpenums.h
|
||
* libgimp/gimpgradientedit_pdb.[ch]
|
||
* plug-ins/pygimp/gimpenums.py
|
||
* plug-ins/script-fu/script-fu-constants.c
|
||
* tools/pdbgen/enums.pl: (re)generated.
|
||
|
||
2004-05-29 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/autocrop.c: applied patch from Philip Lafleur
|
||
that makes Autocrop register a new procedure that autocrops a
|
||
single layer as requested in bug #142618.
|
||
|
||
* tools/pdbgen/pdb/layer.pdb
|
||
* app/pdb/layer_cmds.c
|
||
* libgimp/gimplayer_pdb.c: fixed documentation for gimp_resize_layer.
|
||
Patch provided by Philip Lafleur (bug #142618).
|
||
|
||
2004-05-29 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimptemplateeditor.c
|
||
(gimp_template_editor_constructor): add the spinbuttons to the
|
||
size entry in the correct order. Fixes bug #143347.
|
||
|
||
2004-05-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpdnd.c (gimp_dnd_open_files): if the dropped
|
||
stuff is a local filename (no file URI), convert it to an
|
||
URI instead of forwarding it unmodified.
|
||
|
||
2004-05-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimppreview.c (gimp_preview_button_press_event):
|
||
don't invoke the popup preview if there is no viewable.
|
||
|
||
2004-05-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimppropwidgets.c: same workaround for tooltips on
|
||
combo boxes.
|
||
|
||
2004-05-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/Lighting/lighting_ui.c
|
||
* plug-ins/MapObject/mapobject_ui.c
|
||
* plug-ins/common/warp.c
|
||
* plug-ins/gfig/gfig.c: tooltips can't be set on a GtkComboBox so
|
||
we need to pack it into a GtkEventBox when a tooltip is needed.
|
||
|
||
2004-05-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/text/gimpfont.c (gimp_font_get_popup_size)
|
||
(gimp_font_get_new_preview): take both logical and ink rectangle
|
||
into account to avoid clipping away parts of the font preview.
|
||
Fixes bug #142277.
|
||
|
||
2004-05-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontainerview.[ch]: added "preview-size" and
|
||
"preview-border-width" properties. Cleanup.
|
||
|
||
* app/widgets/gimpcontainerbox.c
|
||
* app/widgets/gimpcontainercombobox.c: implement them.
|
||
|
||
2004-05-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontainergridview.[ch]
|
||
* app/widgets/gimpcontainertreeview.[ch]: removed "reorderable"
|
||
from gimp_container_foo_view_new().
|
||
|
||
* app/widgets/gimpcontainereditor.[ch]: removed "reorderable" from
|
||
gimp_container_editor_construct(). Automatically set the view to
|
||
reorderable if the viewed container has no sort_func.
|
||
|
||
* app/widgets/gimpbufferview.c
|
||
* app/widgets/gimpdatafactoryview.c
|
||
* app/widgets/gimpdocumentview.c
|
||
* app/widgets/gimpimageview.c
|
||
* app/widgets/gimptemplateview.c
|
||
* app/widgets/gimptoolview.c
|
||
* app/widgets/gimpundoeditor.c: removed reoderable stuff because
|
||
GimpContainerEditor does this generically now.
|
||
|
||
* app/widgets/gimpcontainerpopup.c
|
||
* app/widgets/gimpfontview.c: set reorderable to FALSE because
|
||
they should not be reodered even if they don't have a sort_func.
|
||
|
||
* app/gui/font-select.c: removed reorderable stuff. Some cleanup.
|
||
|
||
* app/gui/brush-select.c
|
||
* app/gui/gradient-select.c
|
||
* app/gui/palette-select.c
|
||
* app/gui/pattern-select.c: same cleanups as in font-select.c
|
||
|
||
2004-05-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint/gimpbrushcore.c
|
||
* app/paint/gimpdodgeburn.c
|
||
* app/paint/gimppaintcore.[ch]
|
||
* app/tools/gimpairbrushtool.c
|
||
* app/tools/gimpclonetool.c
|
||
* app/tools/gimpconvolvetool.c
|
||
* app/tools/gimpdodgeburntool.c
|
||
* app/tools/gimpinktool.c
|
||
* app/tools/gimppaintbrushtool.c
|
||
* app/tools/gimppenciltool.c
|
||
* app/tools/gimpsmudgetool.c: code review / cleanup.
|
||
|
||
2004-05-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/CML_explorer.c
|
||
* plug-ins/maze/maze_face.c: added size groups.
|
||
|
||
* plug-ins/common/sinus.c: HIG-ified.
|
||
|
||
2004-05-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/Lighting/lighting_ui.c: tuned dialog layout for
|
||
consistency.
|
||
|
||
* plug-ins/common/warp.c: added size groups to nicely align the
|
||
widgets.
|
||
|
||
2004-05-27 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint/gimp-paint.c (gimp_paint_init): register ink between
|
||
airbrush and clone so the stroke dialog's menu of paint functions
|
||
has the same order as the default toolbox order.
|
||
|
||
2004-05-27 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint/gimppaintcore.[ch]: removed enum GimpPaintCoreFlags
|
||
and member GimpPaintCore::flags. Added "gboolean traces_on_window"
|
||
to GimpPaintCoreClass (defaults to FALSE).
|
||
|
||
* app/paint/gimpclone.c: set traces_on_window = TRUE.
|
||
|
||
* app/paint/gimpbrushcore.[ch]: added
|
||
"gboolean handles_changing_brush" to GimpBrushCoreClass (defaults
|
||
to FALSE).
|
||
|
||
* app/paint/gimpclone.c
|
||
* app/paint/gimpdodgeburn.c
|
||
* app/paint/gimperaser.c
|
||
* app/paint/gimppaintbrush.c
|
||
* app/paint/gimppaintcore.c: set handles_changing_brush = TRUE.
|
||
|
||
* app/tools/gimppainttool.c: changed accordingly.
|
||
|
||
2004-05-27 Maurits Rijk <m.rijk@chello.nl>
|
||
|
||
* plug-ins/common/ccanalyze.c: code clean-up. Improved speed a lot
|
||
(500 percent for 1000 x 1000 RGB image) by replacing O(n^2) algorithm
|
||
with O(n) version.
|
||
|
||
* plug-ins/common/gif.c
|
||
* plug-ins/common/gih.c
|
||
* plug-ins/common/glasstile.c
|
||
* plug-ins/common/gqbist.c
|
||
* plug-ins/common/gradmap.c
|
||
* plug-ins/common/gtm.c
|
||
* plug-ins/common/guillotine.c: Use HIG capitalization style plus
|
||
minor code clean-up.
|
||
|
||
2004-05-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/png.c (respin_cmap): handle an empty colormap.
|
||
Fixes bug #143009.
|
||
|
||
2004-05-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimppickbutton.c: applied patch from Philip
|
||
Lafleur that fixes color picking for XInput devices (bug #143166).
|
||
|
||
2004-05-27 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-draw.c (gimp_display_shell_draw_grid):
|
||
fixed handling of grid offsets in the grid drawing routine.
|
||
|
||
2004-05-27 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/widgets-enums.[ch]: added enum GimpActiveColor which
|
||
can be one of { FOREGROUND, BACKGROUND }.
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/gimpfgbgeditor.[ch]: new widget implementing the
|
||
FG/BG/Swap/Default color area known from the toolbox.
|
||
|
||
* app/widgets/gimptoolbox-color-area.c: use the new widget.
|
||
|
||
* app/widgets/gimpcoloreditor.[ch]: replaced the FG/BG buttons and
|
||
the color area by a GimpFgBgEditor.
|
||
|
||
2004-05-27 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpdocumentview.c (gimp_document_view_new):
|
||
gimp_editor_add_action_button() takes a va_list, terminate
|
||
it with NULL. Fixes bug #143258.
|
||
|
||
2004-05-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint/gimpink.c: restored old time/speed sensitivity
|
||
behaviour by doing nothing except figuring if we draw a straight
|
||
line in INIT_PAINT. Instead, do all the Blob creating in
|
||
MOTION_PAINT and special case the initial (null) "motion"
|
||
accordingly.
|
||
|
||
2004-05-26 Maurits Rijk <m.rijk@chello.nl>
|
||
|
||
* plug-ins/common/video.c: code clean-up. Twice as fast now.
|
||
|
||
* plug-ins/common/flarefx.c: removed timing stuff.
|
||
|
||
2004-05-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/core-enums.[ch]: shorter names for the gradient types
|
||
to reduce the width of the blend tool options.
|
||
|
||
2004-05-26 Maurits Rijk <m.rijk@chello.nl>
|
||
|
||
* plug-ins/common/decompose.c
|
||
* plug-ins/common/deinterlace.c
|
||
* plug-ins/common/depthmerge.c
|
||
* plug-ins/common/despeckle.c
|
||
* plug-ins/common/destripe.c
|
||
* plug-ins/common/diffraction.c
|
||
* plug-ins/common/displace.c
|
||
* plug-ins/common/edge.c
|
||
* plug-ins/common/emboss.c
|
||
* plug-ins/common/engrave.c
|
||
* plug-ins/common/exchange.c
|
||
* plug-ins/common/film.c
|
||
* plug-ins/common/flarefx.c: Use HIG capitalization style.
|
||
Added GPL license in a few places. Minor code clean-up.
|
||
|
||
2004-05-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpcolordisplayeditor.c
|
||
* modules/cdisplay_colorblind.c
|
||
* modules/cdisplay_gamma.c
|
||
* modules/cdisplay_highcontrast.c
|
||
* modules/cdisplay_proof.c: HIG-ified color display filters.
|
||
|
||
2004-05-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint/gimppaintcore.[ch]: added "guint32 time" parameters
|
||
to GimpPaintCore::paint() and ::interpolate().
|
||
|
||
* app/paint/gimpairbrush.c
|
||
* app/paint/gimpbrushcore.c
|
||
* app/paint/gimpclone.c
|
||
* app/paint/gimpconvolve.c
|
||
* app/paint/gimpdodgeburn.c
|
||
* app/paint/gimperaser.c
|
||
* app/paint/gimppaintbrush.c
|
||
* app/paint/gimpsmudge.c: changed accordingly.
|
||
|
||
* app/paint/gimpink.c: ditto and use the passed time instead of
|
||
hardcoded dummy values.
|
||
|
||
* app/paint/gimppaintcore-stroke.c: pass '0' as time.
|
||
|
||
* app/tools/gimppainttool.c: pass the GdkEvent time.
|
||
|
||
2004-05-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint/Makefile.am
|
||
* app/paint/gimpink-blob.[ch]
|
||
* app/paint/gimpink.[ch]
|
||
* app/paint/gimpinkoptions.[ch]: new files. Ported the ink tool
|
||
to be a direct GimpPaintCore subclass without any GUI.
|
||
|
||
* app/paint/gimp-paint.c: register GimpInk with the list of paint
|
||
cores.
|
||
|
||
* app/tools/Makefile.am
|
||
* app/tools/gimpinkoptions.[ch]
|
||
* app/tools/gimpinktool-blob.[ch]: removed these files.
|
||
|
||
* app/tools/gimpinkoptions-gui.[ch]: new files containing only
|
||
the GUI for GimpInkOptions.
|
||
|
||
* app/tools/gimpinktool.[ch]: reduced to some few lines which
|
||
implement a simple GimpPaintTool subclass.
|
||
|
||
* app/tools/gimp-tools.c: associate the GimpInk paint_core with
|
||
the GimpInkTool.
|
||
|
||
2004-05-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint/gimppaintcore-stroke.c: check if we really have
|
||
a GimpBrushCore before casting and accessing its members.
|
||
|
||
2004-05-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint/gimpbrushcore.h
|
||
* app/paint/gimppaintcore.h: some cleanup.
|
||
|
||
2004-05-26 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-layer-select.c
|
||
* app/display/gimpprogress.c
|
||
* app/gui/brush-select.c
|
||
* app/gui/color-notebook.c
|
||
* app/gui/convert-dialog.c
|
||
* app/gui/font-select.c
|
||
* app/gui/gradient-select.c
|
||
* app/gui/info-dialog.c
|
||
* app/gui/offset-dialog.c
|
||
* app/gui/palette-select.c
|
||
* app/gui/pattern-select.c
|
||
* app/gui/stroke-dialog.c
|
||
* app/gui/tips-dialog.c
|
||
* app/tools/gimpmeasuretool.c
|
||
* app/tools/gimptexttool.c
|
||
* app/widgets/gimpcolordisplayeditor.c
|
||
* app/widgets/gimpcolorframe.c
|
||
* app/widgets/gimpdevicestatus.c
|
||
* app/widgets/gimpviewabledialog.c: adjusted dialog spacings.
|
||
|
||
2004-05-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint/gimppaintcore.c: don't do special stuff if a virtual
|
||
function doesn't exist. Instead, added default implementations
|
||
which do the special stuff and call the virtual functions
|
||
unconditionally.
|
||
|
||
* app/tools/gimppainttool.c: some stylistic cleanup.
|
||
|
||
2004-05-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint/gimppaintcore.[ch] (gimp_paint_core_paste)
|
||
(gimp_paint_core_replace): replaced the "MaskBuf *paint_mask"
|
||
parameters by "PixelRegion *mask_bufPR", so subclasses can pass in
|
||
any kind of paint_mask buffer and are not restricted to MaskBufs.
|
||
|
||
Also removes implicit knowledge about the MaskBuf originating from
|
||
a brush in paint_mask_to_canvas_buf() and _to_canvas_tiles() which
|
||
don't need to offset the mask by width/2 height/2 any more.
|
||
|
||
Made gimp_paint_core_validate_undo_tiles() and
|
||
gimp_paint_core_validate_canvas_tiles() protected functions.
|
||
|
||
* app/paint/gimpbrushcore.c (gimp_brush_core_paste_canvas)
|
||
(gimp_brush_core_replace_canvas): create correctly positioned
|
||
PixelRegions from the MaskBufs before passing them to the
|
||
paint_core.
|
||
|
||
2004-05-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint/gimppaintcore.[ch]: removed "gdouble scale" parameter
|
||
and added "GimpPaintOptions" in GimpPaintCore::get_paint_area().
|
||
Check if virtual functions exist befoe calling them.
|
||
|
||
* app/paint/gimpbrushcore.[ch]: added "gdouble scale" to GimpBrushCore
|
||
and "gboolean use_scale" to GimpBrushCoreClass (defaults to TRUE).
|
||
Set scale from paint_options in GimpPaintCore::get_paint_area().
|
||
Removed "scale" parameter from gimp_brush_core_paste_canvas()
|
||
and _replace_canvas().
|
||
|
||
* app/paint/gimpsmudge.c (gimp_smudge_class_init): set use_scale
|
||
to FALSE.
|
||
|
||
* app/paint/gimpclone.c
|
||
* app/paint/gimpconvolve.c
|
||
* app/paint/gimpdodgeburn.c
|
||
* app/paint/gimperaser.c
|
||
* app/paint/gimppaintbrush.c: removed all scale calculations and
|
||
simply pass paint_options to GimpPaintCore::get_paint_area().
|
||
|
||
2004-05-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimppainttool.c (gimp_paint_tool_button_press): check
|
||
if the GimpPaintCore really is a GimpBrushCore before casting and
|
||
fiddling with internaly.
|
||
|
||
2004-05-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/paint/Makefile.am
|
||
* app/paint/gimpbrushcore-kernels.h
|
||
* app/paint/gimpbrushcore.[ch]: new GimpPaintCore subclass
|
||
containing all the brush painting specific stuff.
|
||
|
||
* app/paint/gimppaintcore-kernels.h: removed this file.
|
||
|
||
* app/paint/gimppaintcore.[ch]: removed all brush stuff.
|
||
|
||
* app/paint/gimpairbrush.c
|
||
* app/paint/gimpclone.[ch]
|
||
* app/paint/gimpconvolve.[ch]
|
||
* app/paint/gimpdodgeburn.[ch]
|
||
* app/paint/gimperaser.[ch]
|
||
* app/paint/gimppaintbrush.[ch]
|
||
* app/paint/gimppencil.c
|
||
* app/paint/gimpsmudge.[ch]: changed accordingly. Derive all
|
||
classes which used to derive directly from GimpPaintCore from
|
||
GimpBrushCore now. Lots of cleanup.
|
||
|
||
* app/paint/paint-types.h
|
||
* app/paint/gimp-paint.c
|
||
* app/paint/gimppaintcore-stroke.c
|
||
* app/tools/gimppainttool.c
|
||
* tools/kernelgen.c: changed accordingly.
|
||
|
||
2004-05-25 Maurits Rijk <m.rijk@chello.nl>
|
||
|
||
* plug-ins/common/align_layers.c
|
||
* plug-ins/common/animoptimize.c
|
||
* plug-ins/common/animationplay.c
|
||
* plug-ins/common/apply_lens.c
|
||
* plug-ins/common/autocrop.c
|
||
* plug-ins/common/autostretch_hsv.c
|
||
* plug-ins/common/blinds.c
|
||
* plug-ins/common/blur.c
|
||
* plug-ins/common/borderaverage.c
|
||
* plug-ins/common/bz2.c
|
||
* plug-ins/common/c_astretch.c
|
||
* plug-ins/common/ccanalyze.c
|
||
* plug-ins/common/channel_mixer.c
|
||
* plug-ins/common/color_enhance.c
|
||
* plug-ins/common/colorify.c
|
||
* plug-ins/common/colortoalpha.c
|
||
* plug-ins/common/csource.c
|
||
* plug-ins/common/cubism.c
|
||
* plug-ins/common/curve_bend.c: Use HIG capitalization style.
|
||
Added GPL license in a few places. Minor code clean-up.
|
||
|
||
2004-05-25 Sven Neumann <sven@gimp.org>
|
||
|
||
Sorry, couldn't resist to finish this task...
|
||
|
||
* plug-ins/script-fu/script-fu-console.c
|
||
* plug-ins/script-fu/script-fu-scripts.c
|
||
* plug-ins/script-fu/script-fu-server.c: HIG-ified.
|
||
|
||
2004-05-25 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gimpressionist/brush.c
|
||
* plug-ins/gimpressionist/color.c
|
||
* plug-ins/gimpressionist/general.c
|
||
* plug-ins/gimpressionist/gimpressionist.[ch]
|
||
* plug-ins/gimpressionist/orientation.c
|
||
* plug-ins/gimpressionist/orientmap.c
|
||
* plug-ins/gimpressionist/paper.c
|
||
* plug-ins/gimpressionist/placement.c
|
||
* plug-ins/gimpressionist/presets.c
|
||
* plug-ins/gimpressionist/preview.c
|
||
* plug-ins/gimpressionist/size.c
|
||
* plug-ins/gimpressionist/sizemap.c: HIG-ified.
|
||
|
||
2004-05-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpitemtreeview.h: added GimpContext parameters
|
||
to GimpActivateItemFunc, GimpNewItemFunc and GimpEditItemFunc.
|
||
|
||
* app/widgets/gimpdrawabletreeview.c
|
||
* app/widgets/gimpitemtreeview.c: pass the view's context to
|
||
the functions.
|
||
|
||
* app/actions/actions.c (action_data_get_context): return
|
||
gimp_get_user_context() if "data" is a Gimp.
|
||
|
||
* app/actions/channels-commands.[ch]
|
||
* app/actions/layers-commands.[ch]
|
||
* app/actions/vectors-commands.[ch]: added GimpContext parameters
|
||
to the resp. activate, new and edit functions and use the passed
|
||
context instead of gimp_get_user_context().
|
||
|
||
* app/actions/layers-commands.[ch]: removed the merge and flatten
|
||
callbacks.
|
||
|
||
* app/actions/image-commands.[ch]: made public layer merge utility
|
||
function private and cleaned the whole file up a lot.
|
||
|
||
* app/actions/layers-actions.c: use the callbacks from
|
||
image-commands.c for merge and flatten.
|
||
|
||
* app/actions/edit-commands.c
|
||
* app/actions/file-commands.c
|
||
* app/actions/select-commands.c: use action_data_get_context()
|
||
instead of gimp_get_user_context().
|
||
|
||
* app/actions/edit-actions.c: some cleanup.
|
||
|
||
2004-05-25 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/plugindetails.c
|
||
* plug-ins/dbbrowser/dbbrowser_utils.c
|
||
* plug-ins/pagecurl/pagecurl.c: HIG-ified.
|
||
|
||
2004-05-25 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/print/gimp_color_window.c
|
||
* plug-ins/print/gimp_main_window.c: HIG-ified and ported to
|
||
GtkFileChooser.
|
||
|
||
* plug-ins/ifscompose/ifscompose.c (ifsfile_load_response): ported
|
||
forgotten callback to GtkFileChooser.
|
||
|
||
* plug-ins/imagemap/imap_browse.c
|
||
* plug-ins/imagemap/imap_file.c: finished port to GtkFileChooser.
|
||
|
||
2004-05-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/file-actions.c
|
||
* app/actions/file-commands.[ch]: removed action "file-new", added
|
||
action "file-open-from-image".
|
||
|
||
* app/actions/image-actions.c
|
||
* app/actions/image-commands.[ch]: added actions "image-new" and
|
||
"image-new-from-image".
|
||
|
||
* menus/image-menu.xml.in: use the "-from-image" variants of
|
||
the "new" and "open" actions so the dialogs are preconfigured
|
||
from the image they were invoked from (regression fix).
|
||
|
||
* menus/toolbox-menu.xml.in: s/file-new/image-new/.
|
||
|
||
2004-05-24 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/rcm/rcm.h
|
||
* plug-ins/rcm/rcm_dialog.[ch]: rearranged and HIG-ified dialog.
|
||
|
||
2004-05-24 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimptoolbox.c (toolbox_create_tools): added an evil
|
||
hack as workaround for the missing gtk_action_get_accel_closure().
|
||
Re-enables accelerator display in the tool button tooltips.
|
||
|
||
2004-05-24 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/vectors/Makefile.am
|
||
* app/vectors/gimpcoordmath.[ch]: removed...
|
||
|
||
* app/core/Makefile.am
|
||
* app/core/gimpcoords.[ch]: ...and added without the "bezier"
|
||
namespace.
|
||
|
||
* app/vectors/gimpbezierstroke.c: changed accordingly.
|
||
|
||
* app/Makefile.am: force it to link gimpcoords.o
|
||
|
||
2004-05-24 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/config/gimpconfigwriter.c
|
||
* app/core/gimpstrokeoptions.c
|
||
* app/widgets/gimpactiongroup.c
|
||
* app/widgets/gimpcolorframe.h
|
||
* app/widgets/gimpcolorpanel.h
|
||
* app/widgets/gimpcontainerview.[ch]
|
||
* app/widgets/gimptooldialog.h
|
||
* app/widgets/gimpuimanager.c
|
||
* app/widgets/widgets-types.h: fixed various small issues I
|
||
stumbled across when updating the API reference for app/.
|
||
|
||
2004-05-24 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/display/gimpscalecombobox.c
|
||
(gimp_scale_combo_box_mru_remove_last): removed debugging output.
|
||
|
||
2004-05-24 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimptoolinfo.[ch]: derive GimpToolInfo from
|
||
GimpViewable, it doesn't make sense for it to be a GimpData.
|
||
|
||
* app/widgets/gimptooloptionseditor.c
|
||
(gimp_tool_options_editor_get_title): do not append " Options" to
|
||
the tool name. Fixes bug #142280.
|
||
|
||
2004-05-24 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/mblur.c: fixed range check of blur type
|
||
parameter (bug #142965).
|
||
|
||
2004-05-24 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/maze/maze_face.c: fixed a compiler warning.
|
||
|
||
2004-05-24 Sven Neumann <sven@gimp.org>
|
||
|
||
Applied a patch from Philip Lafleur (bug #142808):
|
||
|
||
* app/paint/gimppaintcore.h: define PRESSURE_SCALE to 1.5
|
||
|
||
* app/paint/gimpairbrush.c
|
||
* app/paint/gimpclone.c
|
||
* app/paint/gimpconvolve.c
|
||
* app/paint/gimpdodgeburn.c
|
||
* app/paint/gimperaser.c
|
||
* app/paint/gimppaintbrush.c
|
||
* app/paint/gimpsmudge.c: use the PRESSURE_SCALE constant.
|
||
|
||
2004-05-24 Michael Natterer <mitch@gimp.org>
|
||
|
||
Long overdue core container cleanup:
|
||
|
||
* app/core/gimplist.[ch]: added "unique-names" and "sort-func"
|
||
properties and merged the resp. code from GimpDataList into
|
||
GimpList. Removed "policy" parameters from gimp_list_new() and
|
||
added "unique_names". Added new constructor gimp_list_new_weak().
|
||
Made public function gimp_list_uniquefy_name() private.
|
||
|
||
* app/core/Makefile.am
|
||
* app/core/core-types.h
|
||
* app/core/gimpdatalist.[ch]: removed. Its functionality is
|
||
entirely in GimpList now.
|
||
|
||
* app/core/gimpdata.[ch]: added gimp_data_name_compare() which
|
||
used to live in GimpDataList.
|
||
|
||
* app/core/gimp.c
|
||
* app/core/gimpdatafactory.c
|
||
* app/core/gimpimage.c
|
||
* app/core/gimptoolinfo.c
|
||
* app/core/gimpundostack.c
|
||
* app/paint/gimp-paint.c
|
||
* app/tools/gimp-tools.c
|
||
* app/widgets/gimpdevices.c
|
||
* app/widgets/gimptemplateeditor.c
|
||
* app/widgets/gimpundoeditor.c: changed list creation accordingly.
|
||
|
||
Made gimp->templates, gimp->named_buffers, tool_info->presets and
|
||
the image's lists of layers, channels and vectors automatically
|
||
ensure unique names.
|
||
|
||
* app/widgets/gimptemplateview.c
|
||
* app/actions/file-commands.c
|
||
* app/actions/templates-commands.c
|
||
* app/actions/tool-options-commands.c: removed calls to
|
||
gimp_list_uniquefy_name().
|
||
|
||
* app/core/gimpitem.c: removed major insanity where the items
|
||
themselves where ensuring their unique names. Bah!
|
||
|
||
* app/core/gimplayer.c (gimp_layer_name_changed): chain up
|
||
conditionally.
|
||
|
||
* app/core/gimplayermask.c (gimp_layer_mask_name_changed): removed
|
||
because there is no need any more to keep the parent
|
||
implementation from being invoked.
|
||
|
||
2004-05-23 Sven Neumann <sven@gimp.org>
|
||
|
||
More fixes for bug #142996:
|
||
|
||
* plug-ins/common/postscript.c
|
||
* plug-ins/common/sparkle.c
|
||
* plug-ins/common/sunras.c
|
||
* plug-ins/common/uniteditor.c
|
||
* plug-ins/fits/fits.c: fixed typos.
|
||
|
||
2004-05-23 Sven Neumann <sven@gimp.org>
|
||
|
||
Fixes for bug #142996:
|
||
|
||
* app/gui/preferences-dialog.c: added missing gettext call.
|
||
|
||
* app/config/gimprc-blurbs.h
|
||
* app/core/gimptemplate.c
|
||
* app/gui/gradient-editor-menu.c: fixed typos.
|
||
|
||
2004-05-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpdatalist.c: code cleanup, no logic changed.
|
||
|
||
2004-05-23 Henrik Brix Andersen <brix@gimp.org>
|
||
|
||
* app/config/gimprc-blurbs.h
|
||
* plug-ins/gfig/gfig-spiral.c (spiral_button_press)
|
||
* plug-ins/gimpressionist/orientation.c (create_orientationpage)
|
||
* plug-ins/common/diffraction.c (diffraction_dialog)
|
||
* plug-ins/common/bumpmap.c (bumpmap_dialog)
|
||
* plug-ins/maze/maze.h
|
||
* plug-ins/MapObject/mapobject_apply.c (compute_image)
|
||
* app/tools/gimpmeasuretool.c (gimp_measure_tool_dialog_update)
|
||
* plug-ins/print/gimp_main_window.c (create_scaling_frame): marked
|
||
strings for translation, corrected small typos. Fixes part of bug
|
||
#142996
|
||
|
||
2004-05-23 Žygimantas Beručka <uid0@akl.lt>
|
||
|
||
* configure.in: Added "lt" to ALL_LINGUAS.
|
||
|
||
2004-05-23 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* libgimp/gimp.def: gimp_register_file_handler_mime added
|
||
|
||
2004-05-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/widgets-types.h: reoedered to somehow reflect the
|
||
class hierarchy.
|
||
|
||
Some dockable context handling cleanup:
|
||
|
||
* app/widgets/gimpdocked.[ch]: removed "prev_context" parameter
|
||
from GimpDocked::set_context(). Widgets which need the old context
|
||
to disconnect from should remember it themselves.
|
||
|
||
* app/widgets/gimpdockable.c (gimp_dockable_set_context): don't
|
||
pass the old context to gimp_docked_set_context().
|
||
Some cleanup.
|
||
|
||
* app/widgets/gimpcontainerbox.c
|
||
* app/widgets/gimpcontainereditor.c: changed accordingly.
|
||
|
||
* app/display/gimpnavigationview.[ch]
|
||
* app/widgets/gimpimageeditor.[ch]
|
||
* app/widgets/gimpitemtreeview.[ch]: added a "context" member
|
||
which holds the context set by GimpDocked::set_context().
|
||
|
||
* app/widgets/gimpdrawabletreeview.c: use the view's context
|
||
instead of gimp_get_user_context().
|
||
|
||
* app/widgets/gimpcoloreditor.[ch]: removed separate API to
|
||
set the context because it implements the GimpDockedInterface.
|
||
|
||
* app/widgets/gimpcomponenteditor.c
|
||
* app/widgets/gimperrorconsole.c: pass "menu-factory",
|
||
"menu-identifier" and "ui-path" to g_object_new() instead of
|
||
calling gimp_editor_create_menu() later.
|
||
|
||
Action cleanup partly related to the context stuff above:
|
||
|
||
* app/actions/actions.c (action_data_get_gimp): get the Gimp from
|
||
context->gimp, not gimage->gimp because gimage may be NULL.
|
||
|
||
(action_data_get_context): changed to use the new context members
|
||
added above.
|
||
|
||
* app/actions/channels-actions.c (channels_actions_update): cleanup.
|
||
|
||
* app/actions/edit-actions.c (edit_actions_update): fixed
|
||
sensitivity of "edit-undo-clear".
|
||
|
||
* app/actions/vectors-actions.c (vectors_actions_update): make
|
||
"vectors-merge-visible" sensitive only if there is more than one
|
||
GimpVectors in the image.
|
||
|
||
* app/actions/colormap-editor-actions.c
|
||
* app/actions/gradient-editor-actions.c
|
||
* app/actions/palette-editor-actions.c: added FG/BG color previews
|
||
to actions which take colors from them. Changed code to be safe
|
||
against "context" being NULL.
|
||
|
||
* app/actions/drawable-commands.c:
|
||
s/active_drawable/drawable/g. Makes the code more readable.
|
||
|
||
* app/actions/select-commands.[ch]
|
||
* app/actions/vectors-commands.[ch]: removed public stroke utility
|
||
functions and other stuff which is not needed any more because
|
||
dialog buttons invoke the correct actions now. Moved the
|
||
functions' code to the resp. action callbacks.
|
||
|
||
2004-05-21 Nathan Summers <rock@gimp.org>
|
||
|
||
Somehow some of the changes from my commit on 2004-05-18 seem to have
|
||
gotten lost, including the addition to the ChangeLog. Sorry about that.
|
||
Recommitted.
|
||
|
||
* NEWS: Clarified end-user visible features.
|
||
Made sundry small grammar and consistancy fixes.
|
||
Reorganized list of changes slightly.
|
||
|
||
2004-05-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/paint/gimppaintcore.c (gimp_paint_core_interpolate): better
|
||
fix for bug #123811; patch provided by Philip Lafleur.
|
||
|
||
2004-05-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/preferences-dialog.c: added some GtkSizeGroups and
|
||
changed spacings to improve the dialog layout.
|
||
|
||
* app/gui/file-new-dialog.c
|
||
* app/widgets/gimpgrideditor.c
|
||
* app/widgets/gimptemplateeditor.c: minor changes for consistency.
|
||
|
||
2004-05-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gflare/gflare.c
|
||
* plug-ins/gfli/gfli.c
|
||
* plug-ins/ifscompose/ifscompose.c
|
||
* plug-ins/sel2path/sel2path.c
|
||
* plug-ins/sel2path/sel2path_adv_dialog.c
|
||
* plug-ins/sgi/sgi.c
|
||
* plug-ins/winicon/icodialog.c: HIG-ification.
|
||
|
||
2004-05-21 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/data-commands.c (data_delete_callback): eek, delete
|
||
the data only if "OK" was pressed.
|
||
|
||
2004-05-21 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimperrorconsole.c
|
||
(gimp_error_console_save_ext_clicked): use
|
||
gtk_widget_get_screen(), not window_get_screen() on a button.
|
||
|
||
2004-05-20 Maurits Rijk <m.rijk@chello.nl>
|
||
|
||
* plug-ins/imagemap/imap_*.[ch]: (partly) HIG-ified, replaced
|
||
deprecated widget GtkCList by GtkTreeModel/View (also fixes #136893),
|
||
use file choosers instead of file selectors, minor clean-up.
|
||
|
||
2004-05-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/Lighting/lighting_ui.c
|
||
* plug-ins/MapObject/mapobject_ui.c
|
||
* plug-ins/bmp/bmpwrite.c
|
||
* plug-ins/fits/fits.c
|
||
* plug-ins/flame/flame.c
|
||
* plug-ins/fp/fp.c
|
||
* plug-ins/gfig/gfig-preview.c
|
||
* plug-ins/gfig/gfig.c: HIG-ified.
|
||
|
||
2004-05-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/FractalExplorer/Dialogs.c
|
||
* plug-ins/FractalExplorer/FractalExplorer.c: HIG-ification and
|
||
some code cleanup.
|
||
|
||
2004-05-19 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/pygimp/gimpfu.py: Actually return values from the run
|
||
function. Fixes #141338.
|
||
|
||
2004-05-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/maze/maze_face.c
|
||
* plug-ins/xjt/xjt.c: HIG-ified. Say goodbye to "Parameter Settings".
|
||
|
||
2004-05-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/warp.c
|
||
* plug-ins/common/whirlpinch.c
|
||
* plug-ins/common/wmf.c
|
||
* plug-ins/common/xbm.c
|
||
* plug-ins/common/xpm.c: HIG-ified.
|
||
|
||
2004-05-19 Manish Singh <yosh@gimp.org>
|
||
|
||
* app/actions/file-actions.c: remove unnecessary G_OBJECT() casts.
|
||
|
||
* tools/pdbgen/pdb/help.pdb
|
||
* tools/pdbgen/pdb/image.pdb
|
||
* tools/pdbgen/pdb/paths.pdb
|
||
* tools/pdbgen/pdb/plug_in.pdb: a bit of quoting clean up.
|
||
|
||
* tools/pdbgen/pdb/plug_in.pdb: handle icon_data_length properly.
|
||
|
||
* app/pdb/plug_in_cmds.c: regenerated.
|
||
|
||
2004-05-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/tga.c
|
||
* plug-ins/common/threshold_alpha.c
|
||
* plug-ins/common/tiff.c
|
||
* plug-ins/common/tile.c
|
||
* plug-ins/common/tileit.c
|
||
* plug-ins/common/uniteditor.c
|
||
* plug-ins/common/unsharp.c
|
||
* plug-ins/common/video.c
|
||
* plug-ins/common/vpropagate.c: HIG-ified.
|
||
|
||
2004-05-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/randomize.c
|
||
* plug-ins/common/ripple.c
|
||
* plug-ins/common/sample_colorize.c
|
||
* plug-ins/common/scatter_hsv.c
|
||
* plug-ins/common/sel_gauss.c
|
||
* plug-ins/common/sharpen.c
|
||
* plug-ins/common/shift.c
|
||
* plug-ins/common/smooth_palette.c
|
||
* plug-ins/common/snoise.c
|
||
* plug-ins/common/sobel.c
|
||
* plug-ins/common/sparkle.c
|
||
* plug-ins/common/spread.c
|
||
* plug-ins/common/struc.c
|
||
* plug-ins/common/sunras.c
|
||
* plug-ins/common/svg.c: HIG-ified.
|
||
|
||
2004-05-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpaction.[ch]: new GtkAction subclass which can
|
||
show either a color or viewable preview in GtkImageMenuItem
|
||
proxies.
|
||
|
||
* app/widgets/gimpenumaction.[ch]
|
||
* app/widgets/gimppluginaction.[ch]
|
||
* app/widgets/gimpstringaction.[ch]: derive them from GimpAction.
|
||
|
||
* app/widgets/gimpactiongroup.c (gimp_action_group_add_actions):
|
||
add GimpActions, not GtkActions.
|
||
|
||
(gimp_action_group_set_action_color)
|
||
(gimp_action_group_set_action_viewable): removed all hacks and
|
||
simply set the "color" or "viewable" properties of the GimpAction
|
||
to change. Fixes color/viewable previews in menus.
|
||
|
||
* app/actions/file-actions.c: show previews in the "Open Recent"
|
||
menu items.
|
||
|
||
Unrelated:
|
||
|
||
* app/widgets/widgets-types.h: removed GimpDockedInterface typedef...
|
||
|
||
* app/widgets/gimpdocked.h: ...and added it here. We don't have
|
||
class struct typedefs in the types header either.
|
||
|
||
* app/actions/edit-actions.c: added <Ctrl>+semicolon as shortcut
|
||
for "edit-fill-pattern".
|
||
|
||
* app/actions/gradient-editor-actions.c: added some stock IDs.
|
||
Please comment.
|
||
|
||
2004-05-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/papertile.c
|
||
* plug-ins/common/pat.c
|
||
* plug-ins/common/pixelize.c
|
||
* plug-ins/common/png.c
|
||
* plug-ins/common/postscript.c
|
||
* plug-ins/common/psp.c: HIG-ified.
|
||
|
||
2004-05-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/mapcolor.c
|
||
* plug-ins/common/mblur.c
|
||
* plug-ins/common/mng.c
|
||
* plug-ins/common/mosaic.c
|
||
* plug-ins/common/newsprint.c
|
||
* plug-ins/common/oilify.c: HIG-ified.
|
||
|
||
2004-05-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/hot.c
|
||
* plug-ins/common/iwarp.c
|
||
* plug-ins/common/jpeg.c
|
||
* plug-ins/common/lic.c
|
||
* plug-ins/common/mail.c: HIG-ified.
|
||
|
||
2004-05-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/gauss_iir.c
|
||
* plug-ins/common/gauss_rle.c
|
||
* plug-ins/common/gbr.c
|
||
* plug-ins/common/gee.c
|
||
* plug-ins/common/gee_zoom.c
|
||
* plug-ins/common/gif.c
|
||
* plug-ins/common/gih.c
|
||
* plug-ins/common/glasstile.c
|
||
* plug-ins/common/gtm.c: HIG-ified.
|
||
|
||
2004-05-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/exchange.c: fixed minor dialog layout issues.
|
||
|
||
* plug-ins/common/screenshot.c: added the camera icon to the dialog.
|
||
|
||
* plug-ins/common/film.c
|
||
* plug-ins/common/fractaltrace.c: HIG-ified.
|
||
|
||
2004-05-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/paint/gimppaintcore.c (gimp_paint_core_interpolate): make
|
||
sure that pressure never becomes negative. Fixes bug #123811;
|
||
thanks to Philip Lafleur for investigating this problem.
|
||
|
||
2004-05-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/channel_mixer.c: added some stock icons.
|
||
|
||
* plug-ins/common/edge.c
|
||
* plug-ins/common/emboss.c
|
||
* plug-ins/common/engrave.c
|
||
* plug-ins/common/exchange.c: HIG-ified.
|
||
|
||
* plug-ins/common/sel_gauss.c: tiny changes for a more consistent
|
||
HIG-ification.
|
||
|
||
2004-05-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/plug_in.pdb: made plugin_icon_register() an
|
||
underscore-prefixed function which needs to be wrapped.
|
||
|
||
* libgimp/gimpplugin_pdb.[ch]: regenerated.
|
||
|
||
* libgimp/Makefile.am
|
||
* libgimp/gimp.h
|
||
* libgimp/gimpplugin.[ch]: new files containing
|
||
gimp_plugin_icon_register() which has no "icon_data_length"
|
||
parameter and determines it from the passed icon data.
|
||
|
||
* libgimp/gimp.def: added gimp_plugin_icon_register.
|
||
|
||
* plug-ins/common/plugindetails.c
|
||
* plug-ins/common/screenshot.c
|
||
* plug-ins/common/uniteditor.c
|
||
* plug-ins/print/print.c: don't pass the icon_data_length.
|
||
|
||
2004-05-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/checkerboard.c
|
||
* plug-ins/common/colorify.c
|
||
* plug-ins/common/colortoalpha.c
|
||
* plug-ins/common/compose.c
|
||
* plug-ins/common/convmatrix.c
|
||
* plug-ins/common/csource.c
|
||
* plug-ins/common/cubism.c
|
||
* plug-ins/common/decompose.c
|
||
* plug-ins/common/deinterlace.c
|
||
* plug-ins/common/depthmerge.c
|
||
* plug-ins/common/despeckle.c
|
||
* plug-ins/common/destripe.c
|
||
* plug-ins/common/diffraction.c
|
||
* plug-ins/common/displace.c: HIG-ified.
|
||
|
||
2004-05-18 Michael Natterer <mitch@gimp.org>
|
||
|
||
Allow plug-ins to register menu icons. Fixes bug #120500.
|
||
|
||
* app/core/core-enums.[ch]: added enum GimpIconType which can
|
||
be one of { STOCK_ID, IMAGE_FILE, INLINE_PIXBUF }.
|
||
|
||
* app/config/gimpconfigwriter.[ch] (gimp_config_writer_data)
|
||
* app/config/gimpscanner.[ch] (gimp_scanner_parse_data): new
|
||
functions which write/parse raw binary data. Needed for storing
|
||
inline pixbufs in pluginrc.
|
||
|
||
* app/config/gimpconfigwriter.[ch] (gimp_config_writer_identifier):
|
||
new function which writes out an unquoted and unescaped string.
|
||
|
||
* app/plug-in/plug-in-proc.[ch] (struct PlugInProcDef): added
|
||
new members "icon_type", "icon_data_length" and "icon_data".
|
||
Reordered members so file_proc specific stuff is at the end.
|
||
|
||
(plug_in_proc_def_get_stock_id)
|
||
(plug_in_proc_def_get_pixbuf): new functions to access the
|
||
procedure's icon.
|
||
|
||
* app/plug-in/plug-in-rc.c: save/restore the registered icons.
|
||
|
||
* app/actions/file-dialog-actions.c
|
||
* app/actions/plug-in-actions.c: set the action's stock ID from
|
||
the procedure's stock ID.
|
||
|
||
* app/widgets/gimppluginaction.c
|
||
(gimp_plug_in_action_connect_proxy): if the procedure provides a
|
||
pixbuf, set it as icon for the menu item.
|
||
|
||
* app/menus/file-dialog-menu.[ch]
|
||
* app/menus/file-open-menu.c
|
||
* app/menus/file-save-menu.c
|
||
* app/xcf/xcf.c: changed accordingly.
|
||
|
||
* tools/pdbgen/pdb/plug_in.pdb (plugin_icon_register): new PDB
|
||
function which can be called during query().
|
||
|
||
* tools/pdbgen/enums.pl
|
||
* app/pdb/internal_procs.c
|
||
* app/pdb/plug_in_cmds.c
|
||
* libgimp/gimpenums.h
|
||
* libgimp/gimpplugin_pdb.c
|
||
* libgimp/gimpplugin_pdb.h
|
||
* plug-ins/pygimp/gimpenums.py
|
||
* plug-ins/script-fu/script-fu-constants.c: regenerated.
|
||
|
||
* plug-ins/common/plugindetails.c
|
||
* plug-ins/common/uniteditor.c
|
||
* plug-ins/print/print.c: register stock_id icons.
|
||
|
||
* plug-ins/common/screenshot.c: register an inline_pixbuf icon for
|
||
testing purposes (used emblem-camera.png from gnome-icon-theme).
|
||
|
||
* app/actions/dialogs-actions.c
|
||
* app/actions/file-actions.c: unrelated: added some more icons
|
||
to menu items.
|
||
|
||
2004-05-18 Maurits Rijk <m.rijk@chello.nl>
|
||
|
||
* plug-ins/common/sel_gauss.c: HIGified, fixed indendation, speed
|
||
improvement (around 70 %).
|
||
|
||
2004-05-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/blur.c
|
||
* plug-ins/common/borderaverage.c
|
||
* plug-ins/common/bumpmap.c
|
||
* plug-ins/common/ccanalyze.c: HIG-ified.
|
||
|
||
2004-05-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpsizeentry.[ch] (gimp_size_entry_attach_label):
|
||
return the created label widget so that it can for example be put
|
||
into a GtkSizeGroup.
|
||
|
||
* plug-ins/libgimpoldpreview/gimpoldpreview.[ch]: removed the
|
||
optional "Preview" frame. Always put the preview into a sunken
|
||
frame.
|
||
|
||
* plug-ins/common/AlienMap2.c
|
||
* plug-ins/common/blinds.c
|
||
* plug-ins/common/flarefx.c
|
||
* plug-ins/common/glasstile.c
|
||
* plug-ins/common/grid.c
|
||
* plug-ins/common/illusion.c
|
||
* plug-ins/common/jigsaw.c
|
||
* plug-ins/common/max_rgb.c
|
||
* plug-ins/common/nlfilt.c
|
||
* plug-ins/common/noisify.c
|
||
* plug-ins/common/nova.c
|
||
* plug-ins/common/plasma.c
|
||
* plug-ins/common/polar.c
|
||
* plug-ins/common/waves.c
|
||
* plug-ins/common/wind.c: changed accordingly, HIG-ified.
|
||
|
||
2004-05-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/aa.c
|
||
* plug-ins/common/align_layers.c
|
||
* plug-ins/common/animationplay.c
|
||
* plug-ins/common/apply_lens.c: HIG-ified.
|
||
|
||
2004-05-18 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimptoolinfo.c: made the "visible" property serializable.
|
||
|
||
* app/tools/gimp-tools.c: store the tools' order and visibility
|
||
in a new config file called "toolrc".
|
||
|
||
2004-05-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gimpressionist/brush.c: ported to GtkFileChooser.
|
||
|
||
* plug-ins/gimpressionist/gimpressionist.h
|
||
* plug-ins/gimpressionist/ppmtool.[ch]: sprinkled some const
|
||
qualifiers.
|
||
|
||
2004-05-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/curve_bend.c
|
||
* plug-ins/ifscompose/ifscompose.c: ported to GtkFileChooser and
|
||
HIG-ified.
|
||
|
||
2004-05-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/channel_mixer.c
|
||
* plug-ins/common/gqbist.c: ported to GtkFileChooser and
|
||
HIG-ified.
|
||
|
||
* plug-ins/common/spheredesigner.c: ditto, but needs more love.
|
||
|
||
2004-05-18 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/plug-in/plug-in-proc.[ch] (plug_in_proc_def_get_label): new
|
||
function which returns a newly allocated string which is the menu
|
||
item's name stripped of mnemonics an ellipses.
|
||
|
||
* app/actions/plug-in-actions.c (plug_in_actions_update)
|
||
* app/plug-in/plug-in.c (plug_in_get_undo_desc): use the function
|
||
instead of implementing the same twice slightly different.
|
||
|
||
2004-05-17 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/CEL.c
|
||
* plug-ins/common/CML_explorer.c: ported to GtkFileChooser and
|
||
HIG-ified.
|
||
|
||
2004-05-17 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/AlienMap2.c: HIG-ified (more or less).
|
||
|
||
2004-05-17 Michael Natterer <mitch@gimp.org>
|
||
|
||
* menus/menus.xsl: put the image popup menu into a dummy menubar
|
||
to work around the silly GtkUIManager restriction that popup menus
|
||
can't have tearoff items.
|
||
|
||
* app/menus/menus.c
|
||
* app/menus/image-menu.c
|
||
* app/display/gimpdisplayshell-callbacks.c
|
||
* app/gui/gui-vtable.c
|
||
* app/menus/plug-in-menus.c: changed accordingly.
|
||
|
||
* app/gui/gui.c (gui_restore_after_callback): connect to
|
||
"notify::tearoff-menus" of GimpGuiConfig and reconfigure the
|
||
global image UI manager accordingly.
|
||
|
||
* app/config/gimpguiconfig.c: removed GIMP_PARAM_RESTART from the
|
||
"tearoff-menus" property because GtkUIManager can change this on
|
||
the fly.
|
||
|
||
* app/display/gimpdisplayshell.[ch]: added the menubar to the
|
||
GimpDisplayShell struct. Some cleanup in gimp_display_shell_new().
|
||
|
||
* app/display/gimpdisplayshell-appearance.c
|
||
(gimp_display_shell_set_show_menubar): use shell->menubar instead
|
||
of asking the UI manager.
|
||
|
||
* app/widgets/gimpuimanager.[ch]: changed gimp_ui_manager_ui_get()
|
||
to transparently load the XML files even if a sub-widget was
|
||
requested. Reordered parameters of gimp_ui_manager_ui_popup().
|
||
Lots of internal cleanups.
|
||
|
||
* app/widgets/gimpdockable.c
|
||
* app/widgets/gimptooloptionseditor.c: simplified accordingly.
|
||
|
||
* app/widgets/gimpeditor.[ch]: added new function
|
||
gimp_editor_popup_menu() which takes a GimpMenuPositionFunc and
|
||
updates/shows the editor's menu.
|
||
|
||
* app/widgets/gimpcolormapeditor.c
|
||
* app/widgets/gimpcomponenteditor.c
|
||
* app/widgets/gimpcontainereditor.c
|
||
* app/widgets/gimpcontainergridview.c
|
||
* app/widgets/gimpcontainertreeview.c
|
||
* app/widgets/gimperrorconsole.c
|
||
* app/widgets/gimpgradienteditor.c
|
||
* app/widgets/gimpitemtreeview.c
|
||
* app/widgets/gimppaletteeditor.c: use gimp_editor_popup_menu().
|
||
|
||
* app/widgets/gimptoolbox.c: moved all code from
|
||
gimp_toolbox_new() to GObject::constructor().
|
||
|
||
2004-05-17 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/tool-options-actions.c: added icons to the Save,
|
||
Load, Rename and Delete submenus.
|
||
|
||
2004-05-17 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/edit-actions.c (edit_actions_update): don't forget
|
||
to set the sensitivity of "edit-named-copy".
|
||
|
||
2004-05-17 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpimage.c (gimp_image_init): initialize the image
|
||
unit to GIMP_UNIT_PIXEL.
|
||
|
||
* app/pdb/image_cmds.c
|
||
* tools/pdbgen/pdb/image.pdb: allow GIMP_UNIT_PIXEL to be used
|
||
in the gimp_image_set_unit() PDB call.
|
||
|
||
2004-05-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/old-photo.scm: fixed wrong use of
|
||
layer ID; bug #142326.
|
||
|
||
2004-05-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimpcurvestool.c: fixed position of vertical line
|
||
indicating the picked color. Patch from William Skaggs and
|
||
Søren Wedel Nielsen; fixes bug #142506.
|
||
|
||
2004-05-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/plug-in/plug-in-params.c (plug_in_proc_args_check): changed
|
||
warnings to include the invalid menu path. Added check that makes
|
||
sure menu paths are either "<Prefix>" or "<Prefix>/foo" but *not*
|
||
"<Prefix>foo".
|
||
|
||
* app/actions/plug-in-actions.c: added function
|
||
plug_in_actions_check_translation() which validates both the
|
||
original and translated menu paths and spits detailed error
|
||
messages if any of them is broken. Made action creation simpler
|
||
(?) and more robust.
|
||
|
||
* app/menus/plug-in-menus.c: argh, the translated menu path must
|
||
be a sorting criteria *only*. Fixed the whole stuff to always use
|
||
the original menu path because translation is done entirely by
|
||
plug-in-actions.c. Fixes bad crashes for all locales. Added
|
||
boolean return value to plug_in_menus_build_path() and don't try
|
||
to create the menu item in an invalid location if creating the
|
||
submenus failed.
|
||
|
||
2004-05-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/menus/file-dialog-menu.c: check if the file procedure
|
||
registered a menu path at all. The menu should probably be created
|
||
from the registered menu path, not from gimp->[load|save]_procs.
|
||
|
||
* app/plug-in/plug-in-proc.[ch]
|
||
* app/plug-in/plug-ins.c: removed broken code that used to sort
|
||
the file procedures.
|
||
|
||
* plug-ins/common/CEL.c
|
||
* plug-ins/common/bz2.c
|
||
* plug-ins/common/gz.c
|
||
* plug-ins/common/pcx.c
|
||
* plug-ins/common/pix.c
|
||
* plug-ins/common/sunras.c
|
||
* plug-ins/sgi/sgi.c
|
||
* plug-ins/xjt/xjt.c: register a mimetype, set a translatable
|
||
action name (mostly taken from shared-mime-info) and register to
|
||
the <Load> and <Save> menus using gimp_plugin_menu_register().
|
||
|
||
2004-05-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/pdb/fileops_cmds.c
|
||
* libgimp/gimpfileops_pdb.c: regenerated.
|
||
|
||
2004-05-14 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/select-actions.c (select_actions_update): don't
|
||
make "select-invert" insensitive if there is no selection.
|
||
|
||
2004-05-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/aa.c
|
||
* plug-ins/common/gbr.c
|
||
* plug-ins/common/gih.c
|
||
* plug-ins/common/gtm.c
|
||
* plug-ins/common/header.c
|
||
* plug-ins/common/pat.c
|
||
* plug-ins/common/pnm.c
|
||
* plug-ins/common/psp.c
|
||
* plug-ins/fits/fits.c
|
||
* plug-ins/gfli/gfli.c: register a mimetype, set a translatable
|
||
action name (mostly taken from shared-mime-info) and register to
|
||
the <Load> and <Save> menus using gimp_plugin_menu_register().
|
||
|
||
2004-05-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/fileops.pdb: added new PDB function
|
||
gimp_register_file_handler_mime() that allows to associate a MIME
|
||
type with a file procecdurre.
|
||
|
||
* app/pdb/fileops_cmds.c
|
||
* app/pdb/internal_procs.c
|
||
* libgimp/gimpfileops_pdb.[ch]: regenerated.
|
||
|
||
* app/plug-in/plug-in-proc.[ch]
|
||
* app/plug-in/plug-in-rc.c
|
||
* app/plug-in/plug-ins.[ch]: store a mimetype with file procedures.
|
||
|
||
* app/actions/file-commands.c
|
||
* app/core/gimpdocumentlist.[ch]
|
||
* app/core/gimpimagefile.[ch]
|
||
* app/file/file-open.[ch]
|
||
* app/file/file-save.c: set the thumbnail's mimetype from the file
|
||
procedure used to load/save the image.
|
||
|
||
* app/xcf/xcf.c
|
||
* plug-ins/bmp/bmp.c
|
||
* plug-ins/common/csource.c
|
||
* plug-ins/common/dicom.c
|
||
* plug-ins/common/gif.c
|
||
* plug-ins/common/gifload.c
|
||
* plug-ins/common/jpeg.c
|
||
* plug-ins/common/mng.c
|
||
* plug-ins/common/png.c
|
||
* plug-ins/common/postscript.c
|
||
* plug-ins/common/psd.c
|
||
* plug-ins/common/psd_save.c
|
||
* plug-ins/common/sunras.c
|
||
* plug-ins/common/svg.c
|
||
* plug-ins/common/tga.c
|
||
* plug-ins/common/tiff.c
|
||
* plug-ins/common/wmf.c
|
||
* plug-ins/common/xbm.c
|
||
* plug-ins/common/xpm.c
|
||
* plug-ins/common/xwd.c
|
||
* plug-ins/faxg3/faxg3.c
|
||
* plug-ins/winicon/main.c: register a mimetype, set a translatable
|
||
action name (taken from shared-mime-info) and register to the <Load>
|
||
and <Save> menus using gimp_plugin_menu_register().
|
||
|
||
2004-05-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/lib.pl
|
||
* tools/pdbgen/pdbgen.pl: added new procedure variable 'since'
|
||
that allows to specify when a new function was added. Use that
|
||
info to generate an appropriate gtk-doc comment.
|
||
|
||
* tools/pdbgen/pdb/plug_in.pdb: set since = '2.2' for the new
|
||
function gimp_plugin_menu_register().
|
||
|
||
* libgimp/gimpplugin_pdb.c: regenerated.
|
||
|
||
2004-05-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
* menus/tool-options-menu.xml: added "name" attributes to all
|
||
submenus.
|
||
|
||
* app/menus/tool-options-menu.c: use the menu names instead of the
|
||
overly long action names.
|
||
|
||
* app/actions/colormap-editor-commands.c
|
||
* app/actions/tool-options-commands.c: added some callback
|
||
implementations.
|
||
|
||
* app/widgets/gimpcolormapeditor.c
|
||
* app/widgets/gimptooloptionseditor.c: removed the callbacks here
|
||
and use action buttons.
|
||
|
||
* app/actions/actions.c
|
||
* app/actions/colormap-editor-actions.c
|
||
* app/actions/edit-actions.c: code review / cleanup.
|
||
|
||
2004-05-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpcontainer.c (gimp_container_add_handler): don't
|
||
try to lookup detailed "notify::foo" signal specs.
|
||
|
||
2004-05-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimptoolview.[ch]: if in list mode, add an "eye"
|
||
column which toggles tool visibility.
|
||
|
||
2004-05-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/tools-actions.c (tools_actions_update): don't use
|
||
action_data_get_context() to update the "tools" action group
|
||
because it may return NULL. Use gimp_get_user_context() instead
|
||
because the active tool is global regardless of the action group's
|
||
context. Fixes accidential tool hiding when closing the last
|
||
display.
|
||
|
||
2004-05-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpthumb/gimpthumbnail.c (gimp_thumbnail_save_thumb): oops.
|
||
|
||
2004-05-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
Added GimpViewable infrastructure which enables migrating from
|
||
TempBuf to GdkPixbuf for both providing and getting previews:
|
||
|
||
* app/core/gimpviewable.[ch]: added new virtual functions
|
||
GimpViewable::get_pixbuf() and GimpViewable::get_new_pixbuf()
|
||
which are implemented exactly as get_preview() and
|
||
get_new_preview() except that get_new_pixbuf() has a default
|
||
implementation which creates the pixbuf from a TempBuf.
|
||
|
||
Renamed public functions _get_preview_pixbuf() and
|
||
_get_new_preview_pixbuf() to _get_pixbuf() and _get_new_pixbuf().
|
||
|
||
Added gimp_viewable_get_dummy_pixbuf() and use it from
|
||
gimp_viewable_get_dummy_preview().
|
||
|
||
* app/core/gimpimagefile.c (gimp_imagefile_save_thumb)
|
||
* app/display/gimpdisplayshell.c (gimp_display_shell_update_icon)
|
||
* app/gui/resize-dialog.c (resize_dialog_new): changed accordingly.
|
||
|
||
2004-05-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpthumb/gimpthumbnail.[ch]: added mime-type support.
|
||
|
||
2004-05-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/menus/Makefile.am: added file-menu.[ch] and
|
||
file-dialog-menu.[ch]
|
||
|
||
* app/menus/menus.[ch]: removed menus_open_recent_add()...
|
||
|
||
* app/menus/file-menu.[ch]: ...and added it here as file_menu_setup().
|
||
|
||
* app/menus/image-menu.c
|
||
* app/menus/toolbox-menu.c: changed accordingly.
|
||
|
||
* app/menus/file-dialog-menu.[ch]: added factored out code from the
|
||
file-open and file-save menus as file_dialog_menu_setup().
|
||
|
||
* app/menus/file-open-menu.c
|
||
* app/menus/file-save-menu.c: call file_dialog_menu_setup().
|
||
|
||
2004-05-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/documents-actions.c
|
||
* app/actions/documents-commands.c
|
||
* app/actions/edit-actions.c
|
||
* app/actions/edit-commands.[ch]
|
||
* app/actions/layers-actions.c
|
||
* app/actions/layers-commands.c
|
||
* app/actions/select-actions.c
|
||
* app/actions/select-commands.[ch]
|
||
* app/actions/vectors-actions.c
|
||
* app/actions/vectors-commands.[ch]: added tooltips for actions
|
||
which are now used for dialog buttons, added callback
|
||
implementations which formerly lived in various widgets, moved
|
||
some actions around and did some general cleanups.
|
||
|
||
* menus/image-menu.xml.in: s/edit-stroke/select-stroke/
|
||
|
||
* menus/Makefile.am
|
||
* menus/selection-editor-menu.xml: new popup menu.
|
||
|
||
* app/menus/menus.c: register <SelectionEditor> and <UndoEditor>
|
||
UI managers.
|
||
|
||
* app/widgets/gimpeditor.[ch]: added construct properties
|
||
"menu-factory", "menu-identifier", "ui-path" and "popup-data".
|
||
Implement GObject::constructor() and create the UI manager
|
||
if all needed properties were set. Enables creating action
|
||
buttons at widget construction time because they need a
|
||
UI manager.
|
||
|
||
(gimp_editor_add_action_button): extended to take a va_list of
|
||
"extended" actions which are invoked if the resp. button emits
|
||
"extended_clicked". Store the actions and their modifier masks in
|
||
a list attached to the button.
|
||
|
||
* app/widgets/gimpcontainerview.c
|
||
(gimp_container_view_item_selected): if the view has container
|
||
*and* context, simply change the context and return.
|
||
|
||
(gimp_container_view_context_changed): don't emit "select_item"
|
||
manually but simply call gimp_container_view_select_item().
|
||
|
||
(gimp_container_view_viewable_dropped): use
|
||
gimp_container_view_item_selected() instead of changing the
|
||
context directly.
|
||
|
||
* app/widgets/gimpcontainereditor.c
|
||
(gimp_container_editor_select_item): update the UI manager.
|
||
|
||
* app/widgets/gimpdockable.c: don't try to fiddle with the
|
||
dialog's menu if it doesn't have a ui_path (happens if the UI
|
||
manager is just a collection of actions for the dialog buttons and
|
||
has no menu registered).
|
||
|
||
* app/widgets/gimpimageeditor.c: connect to the image's "flush"
|
||
signal and update the UI manager in the callback.
|
||
|
||
* app/widgets/gimpitemtreeview.c: use GimpEditor's construct
|
||
properties to create the UI manager so GimpItemTreeView subclasses
|
||
can have action buttons. Update the UI manager in
|
||
gimp_item_tree_view_select_item().
|
||
|
||
* app/widgets/gimpbufferview.c
|
||
* app/widgets/gimpcolormapeditor.c
|
||
* app/widgets/gimpcontainergridview.c
|
||
* app/widgets/gimpdatafactoryview.c
|
||
* app/widgets/gimpfontview.c
|
||
* app/widgets/gimpimageview.c
|
||
* app/widgets/gimptemplateview.c
|
||
* app/widgets/gimptoolview.c: changed calls to
|
||
gimp_editor_add_action_button() accordingly and removed some
|
||
unneeded select_item() implementations.
|
||
|
||
* app/widgets/gimpchanneltreeview.c
|
||
* app/widgets/gimpvectorstreeview.[ch]
|
||
* app/widgets/gimpdocumentview.[ch]
|
||
* app/widgets/gimplayertreeview.c
|
||
* app/widgets/gimpselectioneditor.[ch]
|
||
* app/widgets/gimpundoeditor.[ch]: use action buttons and removed
|
||
lots of callbacks which went to the resp. action callbacks.
|
||
|
||
* app/widgets/widgets-types.h: removed some now unneeded function
|
||
prototypes.
|
||
|
||
* app/gui/dialogs-constructors.c: changed (simplified) many dialog
|
||
constructors accordingly.
|
||
|
||
2004-05-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpwidgets.c (gimp_scale_entry_new_internal)
|
||
* app/widgets/gimpwidgets-utils.c (gimp_table_attach_stock):
|
||
left-align the label.
|
||
|
||
* app/actions/channels-commands.c
|
||
* app/actions/layers-commands.c
|
||
* app/actions/qmask-commands.c
|
||
* app/actions/vectors-commands.c
|
||
* app/display/gimpdisplayshell-scale.c
|
||
* app/gui/brush-select.c
|
||
* app/gui/file-new-dialog.c
|
||
* app/gui/info-dialog.c
|
||
* app/gui/info-window.c
|
||
* app/gui/module-browser.c
|
||
* app/gui/offset-dialog.c
|
||
* app/gui/palette-import-dialog.c
|
||
* app/gui/preferences-dialog.c
|
||
* app/gui/resize-dialog.c
|
||
* app/tools/gimpblendoptions.c
|
||
* app/tools/gimpcroptool.c
|
||
* app/tools/gimpmeasuretool.c
|
||
* app/tools/gimppaintoptions-gui.c
|
||
* app/tools/gimpscaletool.c
|
||
* app/tools/gimpselectionoptions.c
|
||
* app/tools/gimpsheartool.c
|
||
* app/tools/gimptextoptions.c
|
||
* app/widgets/gimpcolormapeditor.c
|
||
* app/widgets/gimpgrideditor.c
|
||
* app/widgets/gimphistogrameditor.c
|
||
* app/widgets/gimplayertreeview.c
|
||
* app/widgets/gimpstrokeeditor.c
|
||
* app/widgets/gimpwidgets-utils.c: left-align labels as suggested
|
||
by the HIG.
|
||
|
||
2004-05-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/config/gimpconfig-deserialize.c
|
||
* app/config/gimpscanner.c
|
||
* app/core/gimp-edit.c
|
||
* app/core/gimpchannel-combine.c
|
||
* app/core/gimpcontainer.c
|
||
* app/core/gimpdrawable-bucket-fill.c
|
||
* app/core/gimpdrawable-combine.c
|
||
* app/core/gimpdrawable.c
|
||
* app/core/gimpgradient.c
|
||
* app/core/gimpimage-flip.c
|
||
* app/core/gimpimage-merge.c
|
||
* app/core/gimpimage-projection.c
|
||
* app/core/gimpimage.c
|
||
* app/display/gimpdisplay-handlers.c
|
||
* app/display/gimpdisplayshell-callbacks.c
|
||
* app/display/gimpprogress.c
|
||
* app/gui/info-dialog.c
|
||
* app/gui/module-browser.c
|
||
* app/gui/offset-dialog.c
|
||
* app/plug-in/plug-in.c
|
||
* app/tools/gimpdrawtool.c
|
||
* app/tools/tool_manager.c
|
||
* app/widgets/gimpactiongroup.c
|
||
* app/widgets/gimpdialogfactory.c
|
||
* app/widgets/gimpgradienteditor.c
|
||
* app/widgets/gimpitemfactory.c
|
||
* app/widgets/gimppropwidgets.c
|
||
* app/widgets/gimpwidgets-utils.c
|
||
* app/xcf/xcf-save.c
|
||
* libgimp/gimpexport.c
|
||
* libgimpwidgets/gimphelpui.c
|
||
* libgimpwidgets/gimppixmap.c
|
||
* libgimpwidgets/gimpunitmenu.c: replaced G_GNUC_FUNCTION,
|
||
G_GNUC_PRETTY_FUNCTION, G_STRLOC and hardcoded function names in
|
||
g_warning()s by G_STRFUNC.
|
||
|
||
2004-05-12 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/gradients-actions.c
|
||
* app/actions/palettes-actions.c
|
||
* app/actions/patterns-actions.c: added/fixed tooltips.
|
||
|
||
2004-05-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* configure.in: define G*_DISABLE_DEPRECATED for all G* modules
|
||
except GTK+. Don't do so if compiling against GLib, GTK+ >= 2.5.0
|
||
and Pango >= 1.5.0
|
||
|
||
* libgimpwidgets/gimpoffsetarea.c: s/gdk_gc_unref/g_object_unref/
|
||
|
||
* app/config/gimpconfig-deserialize.c
|
||
* app/widgets/gimpdeviceinfo.c:
|
||
s/g_value_set_foo_take_ownership/g_value_take_foo/
|
||
|
||
* app/text/gimptext-vectors.c
|
||
* app/text/gimptext-bitmap.c:
|
||
s/pango_ft2_font_get_face/pango_fc_font_lock,unlock_face/
|
||
|
||
2004-05-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/images-commands.c: added missing #includes.
|
||
|
||
2004-05-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpcontainermenu.[ch]
|
||
* app/widgets/gimpcontainermenuimpl.[ch]
|
||
* app/widgets/gimpmenuitem.[ch]: removed. Obsoleted by
|
||
GimpContainerViewInterface implemented by GimpContainerComboBox.
|
||
|
||
2004-05-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/actions.[ch]: added action_data_get_context() and
|
||
macro return_if_no_context().
|
||
|
||
* app/actions/brushes-actions.c
|
||
* app/actions/buffers-actions.c
|
||
* app/actions/buffers-commands.c
|
||
* app/actions/data-commands.c
|
||
* app/actions/fonts-actions.c
|
||
* app/actions/fonts-commands.c
|
||
* app/actions/gradients-actions.c
|
||
* app/actions/images-actions.c
|
||
* app/actions/images-commands.c
|
||
* app/actions/palettes-actions.c
|
||
* app/actions/patterns-actions.c
|
||
* app/actions/templates-actions.c
|
||
* app/actions/templates-commands.[ch]
|
||
* app/actions/tools-actions.c
|
||
* app/actions/tools-commands.c: moved lots of code from widgets/
|
||
to the resp. action callbacks.
|
||
|
||
* app/widgets/gimpeditor.[ch]: added gimp_editor_add_action_button()
|
||
which creates a GtkButton connected to the resp. action.
|
||
|
||
* app/widgets/gimpdatafactoryview.[ch]: added "action_group"
|
||
parameters so we can distinguish brushes, patterns etc. actions.
|
||
|
||
* app/widgets/gimpimageview.[ch]
|
||
* app/widgets/gimpbrushfactoryview.c
|
||
* app/widgets/gimpbufferview.c
|
||
* app/widgets/gimpfontview.c
|
||
* app/widgets/gimpgradienteditor.c
|
||
* app/widgets/gimppatternfactoryview.c
|
||
* app/widgets/gimptemplateview.[ch]
|
||
* app/widgets/gimptoolview.c: removed tons of GtkButton::clicked()
|
||
callbacks and use gimp_editor_add_action_button() instead
|
||
of simply _add_button().
|
||
|
||
* app/gui/dialogs-constructors.c
|
||
* app/gui/gradient-select.c
|
||
* app/gui/palette-select.c
|
||
* app/gui/pattern-select.c: changed accordingly.
|
||
|
||
2004-05-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpcontainercombobox.c: correctly get the default
|
||
GimpContainerViewInterface implementation and chain up to it for
|
||
clear_items(). Update the preview renderers on "update", enable
|
||
deselecting everything.
|
||
|
||
* app/widgets/gimpimagedock.[ch]
|
||
* app/gui/file-new-dialog.c
|
||
* app/gui/palette-import-dialog.c
|
||
* app/gui/preferences-dialog.c
|
||
* app/gui/stroke-dialog.c: use GimpContainerComboBox instead of
|
||
GimpContainerMenuImpl.
|
||
|
||
* app/gui/palette-import-dialog.c: cleanup.
|
||
|
||
2004-05-11 Sven Neumann <sven@gimp.org>
|
||
|
||
* docs/gimptool.1.in: fixed spelling.
|
||
|
||
2004-05-11 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpcontainertreeview.c: minor cleanup.
|
||
|
||
2004-05-11 Michael Schumacher <schumaml@cvs.gnome.org>
|
||
|
||
* libgimp/gimp.def
|
||
* libgimpbase/gimpbase.def: updated
|
||
|
||
2004-05-11 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/user-install-dialog.c: removed the "Aborting
|
||
Installation" page. We added it as a nice little gimmick but
|
||
obviously people don't understand it's purpose. Fixes bug #142281.
|
||
|
||
2004-05-11 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpcontainercombobox.[ch]: added new widget, almost
|
||
finished.
|
||
|
||
* app/widgets/gimpcontainerview.[ch]: added convenience functions
|
||
to get and set the GimpContainerView properties.
|
||
|
||
* app/widgets/gimpcontainerbox.c: use the convenience functions.
|
||
|
||
* app/gui/file-new-dialog.c: use the new GimpContainerComboBox.
|
||
|
||
* etc/templaterc: use "pixels" as the unit for pixel sized templates.
|
||
|
||
2004-05-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpchanneltreeview.c
|
||
* app/widgets/gimpcontainerbox.[ch]
|
||
* app/widgets/gimpcontainereditor.c
|
||
* app/widgets/gimpcontainergridview.[ch]
|
||
* app/widgets/gimpcontainerpopup.c
|
||
* app/widgets/gimpcontainertreeview.[ch]
|
||
* app/widgets/gimpdatafactoryview.c
|
||
* app/widgets/gimpdocumentview.c
|
||
* app/widgets/gimpfontview.c
|
||
* app/widgets/gimpimageview.c
|
||
* app/widgets/gimpitemtreeview.c
|
||
* app/widgets/gimplayertreeview.c
|
||
* app/widgets/gimppatternfactoryview.c
|
||
* app/widgets/gimptemplateview.c
|
||
* app/widgets/gimpvectorstreeview.c: code review / cleanup.
|
||
|
||
2004-05-11 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpcontainerview.[ch]: made GimpContainerView an
|
||
interface. Added accessors for all members in the private struct
|
||
and made it really private.
|
||
|
||
* app/widgets/gimpcontainerbox.[ch]: derive it from GimpEditor and
|
||
implement GimpContainerViewInterface and its properties.
|
||
|
||
* app/widgets/gimpchanneltreeview.c
|
||
* app/widgets/gimpcontainergridview.c
|
||
* app/widgets/gimpcontainertreeview.c
|
||
* app/widgets/gimpcontainertreeview-dnd.c
|
||
* app/widgets/gimpdrawabletreeview.c
|
||
* app/widgets/gimpitemtreeview.c
|
||
* app/widgets/gimplayertreeview.c
|
||
* app/widgets/gimpvectorstreeview.c: implement
|
||
GimpContainerViewInterface and use the new accessor functions.
|
||
|
||
* app/widgets/gimpcontainerpopup.c
|
||
* app/widgets/gimpdocumentview.c: changed accordingly.
|
||
|
||
* app/widgets/gimptemplateview.c
|
||
* app/widgets/gimpcontainereditor.c
|
||
* app/widgets/gimpundoeditor.c
|
||
* app/actions/palettes-commands.c: #include "gimpcontainerview.h"
|
||
|
||
2004-05-11 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimp.def
|
||
* libgimp/gimpui.def
|
||
* libgimpbase/gimpbase.def
|
||
* libgimpwidgets/gimpwidgets.def: updated.
|
||
|
||
2004-05-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpframe.c (gimp_frame_style_set): removed a
|
||
redundant call to gtk_widget_queue_resize().
|
||
|
||
2004-05-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/xcf/xcf-save.c (xcf_save_prop): fixed size of colormap
|
||
property. Patch by Daniel Kobras, fixes bug #142149.
|
||
|
||
2004-05-10 Henrik Brix Andersen <brix@gimp.org>
|
||
|
||
* plug-ins/common/screenshot.c (shoot_dialog): fixed the spacing
|
||
of the dialog, thanks to Sven for pointing out my mistake.
|
||
|
||
2004-05-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimptexteditor.c (gimp_text_editor_set_direction):
|
||
don't call gtk_widget_set_direction() on a non-existant widget.
|
||
Fixes bug #141792.
|
||
|
||
2004-05-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/tips-dialog.c: added missing newline in error message.
|
||
|
||
2004-05-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
More GimpContainerView chopping:
|
||
|
||
* app/widgets/gimpcontainerview.[ch]: added
|
||
GimpContainerViewPrivate struct (which is currently public :-) and
|
||
removed all members from the GimpContainerView struct. Added
|
||
accessors for "context", "container" and "preview_size /
|
||
preview_border_width". Added macro to get the private struct
|
||
(*not* via G_TYPE_INSTANCE_GET_PRIVATE because that's unavailable
|
||
for interfaces).
|
||
|
||
* app/widgets/gimpbrushfactoryview.c
|
||
* app/widgets/gimpbufferview.c
|
||
* app/widgets/gimpchanneltreeview.c
|
||
* app/widgets/gimpcontainerbox.c
|
||
* app/widgets/gimpcontainereditor.c
|
||
* app/widgets/gimpcontainergridview.c
|
||
* app/widgets/gimpcontainerpopup.c
|
||
* app/widgets/gimpcontainertreeview-dnd.c
|
||
* app/widgets/gimpcontainertreeview.c
|
||
* app/widgets/gimpdatafactoryview.c
|
||
* app/widgets/gimpdocumentview.c
|
||
* app/widgets/gimpfontview.c
|
||
* app/widgets/gimpimageview.c
|
||
* app/widgets/gimpitemtreeview.c
|
||
* app/widgets/gimplayertreeview.c
|
||
* app/widgets/gimpsessioninfo.c
|
||
* app/widgets/gimptemplateview.c
|
||
* app/widgets/gimptoolview.c
|
||
* app/actions/brushes-actions.c
|
||
* app/actions/buffers-actions.c
|
||
* app/actions/dockable-actions.c
|
||
* app/actions/dockable-commands.c
|
||
* app/actions/documents-actions.c
|
||
* app/actions/fonts-actions.c
|
||
* app/actions/gradients-actions.c
|
||
* app/actions/gradients-commands.c
|
||
* app/actions/images-actions.c
|
||
* app/actions/palettes-actions.c
|
||
* app/actions/palettes-commands.c
|
||
* app/actions/patterns-actions.c
|
||
* app/actions/templates-actions.c
|
||
* app/actions/tools-actions.c
|
||
* app/actions/tools-commands.c: changed accordingly.
|
||
|
||
2004-05-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimpmagnifyoptions.[ch]
|
||
* app/tools/gimpmagnifytool.c: applied a patch from William Skaggs
|
||
that changes a misleading option label. Fixes bug #137508.
|
||
|
||
2004-05-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/config/gimpdisplayconfig.c (DEFAULT_IMAGE_TITLE_FORMAT):
|
||
removed the display scale from the default image title because
|
||
it's now displayed in the statusbar. Show the image pixel size
|
||
instead.
|
||
|
||
* app/gui/preferences-dialog.c: include a preset for the title
|
||
format string that shows the image size (bug #141720).
|
||
|
||
2004-05-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
Prepare for making an interface out of GimpContainerView:
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpcontainerbox.[ch]: new GimpContainerView
|
||
subclass which implements GimpDocked interface and contains the
|
||
vbox-with-scrolled-window stuff common to GimpContainerGridView
|
||
and GimpContainerTreeView.
|
||
|
||
* app/widgets/gimpcontainerview.[ch]: removed that functionality
|
||
here.
|
||
|
||
* app/widgets/gimpcontainergridview.[ch]
|
||
* app/widgets/gimpcontainertreeview.[ch]: derive them from
|
||
GimpContainerBox.
|
||
|
||
* app/gui/brush-select.c
|
||
* app/gui/font-select.c
|
||
* app/gui/gradient-select.c
|
||
* app/gui/palette-select.c
|
||
* app/gui/pattern-select.c
|
||
* app/widgets/gimpcontainerpopup.c: changed accordingly.
|
||
|
||
2004-05-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/view-actions.c: added a stock icon for "view-zoom-1-1".
|
||
|
||
* app/widgets/gimpunitcombobox.[ch]: added functions to get and
|
||
set the active unit.
|
||
|
||
* app/widgets/gimpunitstore.c (gimp_unit_store_tree_model_get_value):
|
||
need to special case GIMP_UNIT_PIXEL.
|
||
|
||
* app/display/Makefile.am
|
||
* app/display/display-types.h
|
||
* app/display/gimpscalecombobox.[ch]: new widget to be used in the
|
||
display's statusbar.
|
||
|
||
* app/display/gimpdisplayshell-cursor.[ch]: always display the
|
||
cursor position, not only if the cursor is inside the image. Added
|
||
new function gimp_display_shell_clear_cursor() to clear the cursor
|
||
label.
|
||
|
||
* app/display/gimpdisplayshell-callbacks.c: changed accordingly.
|
||
|
||
* app/display/gimpstatusbar.[ch]
|
||
* app/display/gimpdisplayshell.c
|
||
* app/display/gimpdisplayshell-handlers.c
|
||
* app/display/gimpdisplayshell-scale.c: do not explicitely resize
|
||
the statusbar cursor label, connect to GimpDisplayShell::scaled
|
||
instead. Added a GimpScaleComboBox to the status bar.
|
||
|
||
2004-05-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
Started making the toolbox configurable.
|
||
Addresses bug #105764. Not finished yet.
|
||
|
||
* app/core/gimptoolinfo.[ch]: renamed "in_toolbox" to "visible"
|
||
and made it a GObject property.
|
||
|
||
* app/tools/gimp-tools.[ch]: added new function
|
||
gimp_tools_get_default_order() which returns a GList of tool
|
||
identifiers.
|
||
|
||
* app/actions/tools-actions.c
|
||
* app/actions/tools-commands.[ch]: added actions & callbacks for
|
||
toggling the "visible" boolean and for resetting all tools.
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimptoolview.[ch]: new widget which allows to
|
||
toggle a tool's visibility and to reorder the tools.
|
||
|
||
* app/widgets/gimptoolbox.[ch]: removed member "GtkWidget *trash"
|
||
and pack all tool buttons into the same wrap box. Connect to
|
||
"reoder" of the tool container and to "notify::visible" of all
|
||
tool infos and update the toolbox accordingly.
|
||
|
||
* app/gui/dialogs-constructors.c: create a GimpToolView for the
|
||
tools list/grid.
|
||
|
||
* app/menus/menus.c: register a <Tools> menu for the dialog above.
|
||
|
||
* menus/Makefile.am
|
||
* menus/tools-menu.xml: added the menu.
|
||
|
||
2004-05-10 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpuimanager.c: re-added help for menu items. Still
|
||
incomplete because there is no fallback help ID yet when pressing
|
||
F1 over a menu item which has a submenu. Added evil workaround and
|
||
version check for signal brokenness of GtkUIManager in GTK+ 2.4.1.
|
||
|
||
2004-05-09 Hans Breuer <hans@breuer.org>
|
||
|
||
Merge from stable branch :
|
||
|
||
* plug-ins/common/winclipboard.c : support gray images;
|
||
fixes bug #141382
|
||
|
||
* plug-ins/common/winprint.c : dito; fixes bug #141145
|
||
|
||
2004-05-09 Maurits Rijk <m.rijk@chello.nl>
|
||
|
||
* plug-ins/common/aa.c
|
||
* plug-ins/common/apply_lens.c
|
||
* plug-ins/common/autocrop.c
|
||
* plug-ins/common/autostretch_hsv.c: HIGified, GPL license added in
|
||
some plug-ins, minor code clean-up.
|
||
|
||
2004-05-08 Maurits Rijk <m.rijk@chello.nl>
|
||
|
||
* plug-ins/common/spread.c: HIGified, simplified and fixes #141733
|
||
|
||
2004-05-08 Henrik Brix Andersen <brix@gimp.org>
|
||
|
||
* plug-ins/common/screenshot.c (shoot_dialog): HIGify the
|
||
screenshot plug-in. Fixes part of bug #141772.
|
||
|
||
2004-05-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/display/gimpstatusbar.c (gimp_statusbar_resize_cursor):
|
||
added 1 pixel horizontal padding around the label.
|
||
|
||
2004-05-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/display/gimpstatusbar.[ch]: renamed struct member combo to
|
||
unit_combo. Place the combobox into the cursor frame.
|
||
|
||
2004-05-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpunitcombobox.[ch]
|
||
* app/widgets/gimpunitstore.[ch]: added a prototype of a unit menu
|
||
based on GtkComboBox. Will move this to libgimpwidgets later...
|
||
|
||
* app/display/gimpstatusbar.[ch]: use the new GimpUnitComboBox and
|
||
GimpUnitStore.
|
||
|
||
* themes/Default/gtkrc
|
||
* themes/Small/gtkrc: hardcode the appearance of the
|
||
GimpUnitComboBox. It uses a hack that doesn't work in list mode.
|
||
|
||
2004-05-07 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpimage-colormap.[ch]: added a const qualifier.
|
||
|
||
Changed how the image unit and dot-for-dot mode is handled. Might
|
||
break things and certainly needs more changes (mainly in tools):
|
||
|
||
* app/core/gimptemplate.c: allow GIMP_UNIT_PIXEL as image unit.
|
||
|
||
* app/display/gimpdisplayshell-handlers.c
|
||
* app/display/gimpdisplayshell-scale.c
|
||
* app/display/gimpdisplayshell-title.c
|
||
* app/display/gimpstatusbar.c: always use the image unit for the
|
||
rulers and to display lengths.
|
||
|
||
* app/widgets/gimptemplateeditor.c: redone GimpTemplateEditor
|
||
based on a dialog mockup from Jimmac and Tigert.
|
||
|
||
* app/core/core-enums.[ch]: changed some descriptions used by the
|
||
template editor.
|
||
|
||
2004-05-07 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/AlienMap2.c
|
||
* plug-ins/common/CML_explorer.c
|
||
* plug-ins/common/animationplay.c
|
||
* plug-ins/common/despeckle.c
|
||
* plug-ins/fp/fp.c
|
||
* plug-ins/gfig/gfig.c
|
||
* plug-ins/gflare/gflare.c
|
||
* plug-ins/script-fu/script-fu.c
|
||
* plug-ins/twain/twain.c: forgot some gimp_plugin_menu_register().
|
||
|
||
2004-05-07 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/FractalExplorer/FractalExplorer.c
|
||
* plug-ins/Lighting/lighting_main.c
|
||
* plug-ins/MapObject/mapobject_main.c
|
||
* plug-ins/dbbrowser/dbbrowser.c
|
||
* plug-ins/flame/flame.c
|
||
* plug-ins/gimpressionist/gimp.c
|
||
* plug-ins/ifscompose/ifscompose.c
|
||
* plug-ins/imagemap/imap_main.c
|
||
* plug-ins/maze/maze.c
|
||
* plug-ins/pagecurl/pagecurl.c
|
||
* plug-ins/print/print.c
|
||
* plug-ins/rcm/rcm.c
|
||
* plug-ins/winsnap/winsnap.c
|
||
* plug-ins/common/[g-z]*.c: use gimp_plugin_menu_register(). Some
|
||
formatting cleanups in some query() functions.
|
||
|
||
2004-05-07 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/plug-in/plug-in-proc.[ch]: removed member "accelerator".
|
||
It was never set and this is the conceptually wrong place to store
|
||
it anyway.
|
||
|
||
* app/actions/file-dialog-actions.c
|
||
* app/actions/plug-in-actions.c
|
||
* app/plug-in/plug-in-message.c
|
||
* app/xcf/xcf.c: changed accordingly.
|
||
|
||
* tools/pdbgen/pdb/plug_in.pdb (plugins_query): always return NULL
|
||
as accelerator. Cleaned up the function a bit and made it aware of
|
||
proc_def->menu_label added below.
|
||
|
||
* app/pdb/plug_in_cmds.c: regenerated.
|
||
|
||
2004-05-07 Michael Natterer <mitch@gimp.org>
|
||
|
||
Changed plug-in menu registration again to allow passing just the
|
||
menu item's label (not the full path) in gimp_install_procedure()
|
||
and only the path (excluding the item's label) in
|
||
gimp_plugin_menu_register(). Matches the internal action system
|
||
better and makes translating the menu paths much easier.
|
||
|
||
(Of yourse it's still possible to use the old syntax for backward
|
||
compatibility).
|
||
|
||
* app/plug-in/plug-in-proc.[ch]: added "gchar *menu_label".
|
||
|
||
* app/plug-in/plug-in-params.[ch]: added new functions
|
||
plug_in_param_defs_check() and plug_in_proc_args_check() which
|
||
check if a procedure's parameters match its menu location
|
||
(e.g. <Image> needs RUN-MODE, IMAGE, DRAWABLE).
|
||
|
||
* app/plug-in/plug-in-message.c (plug_in_handle_proc_install): if
|
||
registering an old-style (full) menu_path, use
|
||
plug_in_param_defs_check(), set proc_def->menu_label otherwise.
|
||
|
||
* tools/pdbgen/pdb/plug_in.pdb (plugin_menu_register): use
|
||
plug_in_proc_args_check() on the passed menu_path and make sure
|
||
old and new style menu registration are not mixed.
|
||
|
||
* app/pdb/plug_in_cmds.c: regenerated.
|
||
|
||
* app/plug-in/plug-in-rc.c: save/restore "menu_label".
|
||
|
||
* app/actions/file-dialog-actions.c
|
||
* app/actions/plug-in-actions.c
|
||
* app/menus/plug-in-menus.c: changed action/menu creation
|
||
accordingly. Some hacks needed to allow both old and new style
|
||
menu_label/menu_paths.
|
||
|
||
* app/plug-in/plug-in.c
|
||
* app/widgets/gimpfiledialog.c
|
||
* app/xcf/xcf.c: changed accordingly.
|
||
|
||
* plug-ins/common/align_layers.c
|
||
* plug-ins/common/animationplay.c
|
||
* plug-ins/common/animoptimize.c
|
||
* plug-ins/common/apply_lens.c
|
||
* plug-ins/common/autocrop.c
|
||
* plug-ins/common/autostretch_hsv.c
|
||
* plug-ins/common/blinds.c
|
||
* plug-ins/common/blur.c
|
||
* plug-ins/common/borderaverage.c
|
||
* plug-ins/common/bumpmap.c
|
||
* plug-ins/common/c_astretch.c
|
||
* plug-ins/common/ccanalyze.c
|
||
* plug-ins/common/channel_mixer.c
|
||
* plug-ins/common/checkerboard.c
|
||
* plug-ins/common/color_enhance.c
|
||
* plug-ins/common/colorify.c
|
||
* plug-ins/common/colortoalpha.c
|
||
* plug-ins/common/compose.c
|
||
* plug-ins/common/convmatrix.c
|
||
* plug-ins/common/cubism.c
|
||
* plug-ins/common/curve_bend.c
|
||
* plug-ins/common/decompose.c
|
||
* plug-ins/common/deinterlace.c
|
||
* plug-ins/common/depthmerge.c
|
||
* plug-ins/common/destripe.c
|
||
* plug-ins/common/diffraction.c
|
||
* plug-ins/common/displace.c
|
||
* plug-ins/common/edge.c
|
||
* plug-ins/common/emboss.c
|
||
* plug-ins/common/engrave.c
|
||
* plug-ins/common/exchange.c
|
||
* plug-ins/common/film.c
|
||
* plug-ins/common/flarefx.c
|
||
* plug-ins/common/fractaltrace.c
|
||
* plug-ins/common/screenshot.c: ported the first few plug-ins
|
||
to the new registration scheme.
|
||
|
||
2004-05-06 Manish Singh <yosh@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/app.pl: make libgimp* headers always included
|
||
before any app headers.
|
||
|
||
* tools/pdbgen/pdb/paint_tools.pdb: Fix silly "Dodgebure" typo.
|
||
|
||
* app/pdb/*_cmds.c: regenerated.
|
||
|
||
2004-05-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpdrawable-preview.c
|
||
* app/core/gimpimage-projection.c: added sanity so we don't just
|
||
plain crash when an indexed image doesn't have a colormap.
|
||
|
||
* plug-ins/common/png.c: keep at least one entry in the colormap.
|
||
Fixes bug #142029.
|
||
|
||
2004-05-06 Maurits Rijk <m.rijk@chello.nl>
|
||
|
||
* plug-ins/common/sobel.c: replaced RMS macro by smarter one,
|
||
resulting in a doubling in speed for this plug-in.
|
||
|
||
* plug-ins/fp/fp.c: include stdlib for free, malloc and abs.
|
||
|
||
2004-05-06 Maurits Rijk <m.rijk@chello.nl>
|
||
|
||
* plug-ins/fp/fp_gdk.c
|
||
* plug-ins/fp/fp_gtk.c
|
||
* plug-ins/fp/fp_misc.c
|
||
* plug-ins/fp/fp.h: removed
|
||
|
||
* plug-ins/fp/Makefile.am: changed accordingly
|
||
|
||
* plug-ins/fp/fp.c: merged into one single file to get rid of all
|
||
global variables and functions. Major clean-up. Still more to come.
|
||
|
||
2004-05-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/about-dialog.c: center the about dialog on the monitor,
|
||
not on the screen. Fixes window position on xinerama setups.
|
||
|
||
2004-05-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/plug_in.pdb: renamed gimp_plugin_menu_add() to
|
||
gimp_plugin_menu_register() for consistency with other
|
||
gimp_plugin_foo_register() functions which can be called during
|
||
query().
|
||
|
||
* app/pdb/plug_in_cmds.c
|
||
* libgimp/gimpplugin_pdb.[ch]: regenerated.
|
||
|
||
* plug-ins/common/ccanalyze.c
|
||
* plug-ins/common/colortoalpha.c
|
||
* plug-ins/common/screenshot.c
|
||
* plug-ins/winsnap/winsnap.c: changed accordingly.
|
||
|
||
2004-05-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
Enabled multiple menu entries per plug-in procedure:
|
||
|
||
* app/plug-in/plug-in-proc.[ch]: changed "gchar *menu_path" to
|
||
"GList *menu_paths".
|
||
|
||
* app/plug-in/plug-in-message.c
|
||
* app/plug-in/plug-in-rc.c
|
||
* app/plug-in/plug-in.c
|
||
* app/plug-in/plug-ins.c
|
||
* app/menus/menus.c
|
||
* app/widgets/gimpfiledialog.c
|
||
* app/xcf/xcf.c: changed accordingly.
|
||
|
||
* app/actions/file-dialog-actions.c
|
||
* app/actions/plug-in-actions.c: create an action for the first
|
||
element of proc_def->menu_paths.
|
||
|
||
* app/gui/gui-vtable.c
|
||
* app/menus/plug-in-menus.[ch]: create proxy widgets for each
|
||
element of proc_def->menu_paths.
|
||
|
||
* tools/pdbgen/pdb/plug_in.pdb: added new function
|
||
gimp_plugin_menu_add() which can be called during query() and adds
|
||
a menu path to a procedure registered by the calling plugin.
|
||
|
||
* app/pdb/internal_procs.c
|
||
* app/pdb/plug_in_cmds.c
|
||
* libgimp/gimpplugin_pdb.[ch]: regenerated.
|
||
|
||
* menus/image-menu.xml.in
|
||
* menus/toolbox-menu.xml.in: added lots of <placeholder>s for
|
||
logical groups (like Image/Resize, Image/Scale, Image/Crop
|
||
etc.). Added empty placeholder File/Send for stuff like print and
|
||
mail. Added an "Acquire" menu under <Image>/File
|
||
|
||
* plug-ins/common/mail.c
|
||
* plug-ins/print/print.c
|
||
* plug-ins/common/winprint.c: register under File/Send.
|
||
|
||
* plug-ins/common/screenshot.c
|
||
* plug-ins/winsnap/winsnap.c: also register under
|
||
<Image>/File/Acquire.
|
||
|
||
* plug-ins/common/autocrop.c
|
||
* plug-ins/common/ccanalyze.c
|
||
* plug-ins/common/colortoalpha.c
|
||
* plug-ins/common/threshold_alpha.c
|
||
* plug-ins/common/zealouscrop.c: register additional menu entries
|
||
under placeholders in the "Image" and "Layer" menus. This is not
|
||
meant to be final but just a hint to keep in mind when
|
||
reorganizing the plug-in menus.
|
||
|
||
2004-05-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/resize-dialog.[ch]: cleaned up variable names and
|
||
external API. Still quite a mess.
|
||
|
||
* app/Makefile.am
|
||
* app/actions/image-commands.c
|
||
* app/actions/layers-commands.c: changed accordingly.
|
||
|
||
2004-05-06 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/menus/menus.c: no need for including gimp-intl.h.
|
||
|
||
2004-05-06 Michael Natterer <mitch@gimp.org>
|
||
|
||
* configure.in
|
||
* app/Makefile.am
|
||
* app/menus/.cvsignore
|
||
* app/menus/Makefile.am
|
||
* app/menus/menus-types.h
|
||
* app/menus/menus.[ch]
|
||
* app/menus/file-open-menu.[ch]
|
||
* app/menus/file-save-menu.[ch]
|
||
* app/menus/image-menu.[ch]
|
||
* app/menus/plug-in-menus.[ch]
|
||
* app/menus/tool-options-menu.[ch]
|
||
* app/menus/toolbox-menu.[ch]: moved all menus files to their
|
||
own directory.
|
||
|
||
* app/gui/Makefile.am
|
||
* app/gui/menus.[ch]
|
||
* app/gui/file-open-menu.[ch]
|
||
* app/gui/file-save-menu.[ch]
|
||
* app/gui/image-menu.[ch]
|
||
* app/gui/plug-in-menus.[ch]
|
||
* app/gui/tool-options-menu.[ch]
|
||
* app/gui/toolbox-menu.[ch]: removed them here.
|
||
|
||
* app/actions/debug-commands.c
|
||
* app/actions/file-commands.c
|
||
* app/gui/brush-select.c
|
||
* app/gui/dialogs.c
|
||
* app/gui/font-select.c
|
||
* app/gui/gradient-select.c
|
||
* app/gui/gui-vtable.c
|
||
* app/gui/gui.c
|
||
* app/gui/palette-select.c
|
||
* app/gui/pattern-select.c
|
||
* app/gui/preferences-dialog.c: changed #includes accordingly.
|
||
|
||
2004-05-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/file-new-dialog.c: use a normal GimpDialog instead of a
|
||
GimpViewableDialog that never has a viewable set.
|
||
|
||
2004-05-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/gui/brush-select.[ch] (brush_select_new): reordered parameters
|
||
so the first four are the same for all foo_select_new() functions.
|
||
|
||
* tools/pdbgen/pdb/brush_select.pdb: changed accordingly.
|
||
|
||
* app/pdb/brush_select_cmds.c: regenerated.
|
||
|
||
* app/gui/font-select.c (font_select_new): set the vbox'
|
||
border width to 6 to match the other foo_select dialogs.
|
||
|
||
2004-05-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/debug-actions.c
|
||
* app/actions/debug-commands.[ch]
|
||
* menus/toolbox-menu.xml.in: added action & callback which XML-dump
|
||
all UI managers.
|
||
|
||
2004-05-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/plug-in-actions.c (plug_in_actions_add_proc): fixed
|
||
bug which would have leaked broken menu translations.
|
||
|
||
* app/gui/plug-in-menus.c: removed useless #includes.
|
||
|
||
2004-05-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/file-actions.c
|
||
* app/actions/file-commands.[ch]: remove "file-close" action and
|
||
callback...
|
||
|
||
* app/actions/view-actions.c
|
||
* app/actions/view-commands.[ch]: ...and added it here as
|
||
"view-close" because that's what it does.
|
||
|
||
* app/actions/qmask-actions.c
|
||
* app/actions/qmask-commands.c: s/QMask/QuickMask/g
|
||
|
||
* app/gui/menus.c: add the "channels" action group to the <Image>
|
||
and <Dock> UI managers, renamed UI manager <Dialogs> to
|
||
<Dockable>.
|
||
|
||
* app/widgets/gimpdockbook.c: s/<Dialogs>/<Dockable>/.
|
||
|
||
* menus/image-menu.xml.in: s/file-close/view-close/, added
|
||
separators at the end of most menus, moved the bottom group of the
|
||
"View" menu after the zoom group.
|
||
|
||
2004-05-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/select-actions.c: removed action "select-by-color".
|
||
|
||
* app/tools/gimpbycolorselecttool.c: add the shortcut here.
|
||
|
||
* app/actions/tools-actions.c: added alternative tool actions for
|
||
"by-color-select" and "rotate" which are identical to the ones
|
||
generated from the GimpToolInfo except for their label. Make sure
|
||
they have the same accelerators as the generated ones.
|
||
|
||
* menus/image-menu.xml.in: use the alternative actions for
|
||
"<Image>/Select/By Color" and
|
||
"<Layer>/Transform/Arbitrary Rotation...".
|
||
|
||
2004-05-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimphelpui.c: documentation.
|
||
|
||
2004-05-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
Finally enable global accelerators in all docks:
|
||
|
||
* app/widgets/gimpimagedock.c (gimp_image_dock_constructor):
|
||
iterate all of the UI manager's actions and enable their
|
||
accelerators manually. Fixes bug #119878.
|
||
|
||
2004-05-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpviewabledialog.c: added construct properties to
|
||
make it possible to derive from GimpViewableDialog.
|
||
|
||
* app/widgets/gimptooldialog.[ch]: make GimpToolDialog a real
|
||
object, not just a convenience constructor.
|
||
|
||
* themes/Default/gtkrc
|
||
* themes/Small/gtkrc: set a smaller border_width of 6 pixels for
|
||
the action area of tool dialogs.
|
||
|
||
* app/tools/gimpcolorpickertool.c
|
||
* app/tools/gimpimagemaptool.c: set a smaller border_width of 6
|
||
pixels on tool dialogs to make them more compact.
|
||
|
||
2004-05-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimpoffsetarea.[ch]: added new function
|
||
gimp_offset_area_set_pixbuf(). Started to clean up the
|
||
code a bit.
|
||
|
||
* app/gui/resize-dialog.c (resize_widget_new): use the new feature
|
||
and set a preview of the image. Fixes bug #78733.
|
||
|
||
2004-05-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/info-dialog.c
|
||
* app/tools/gimpcolorbalancetool.c
|
||
* app/tools/gimpcolorizetool.c
|
||
* app/tools/gimpcurvestool.c
|
||
* app/tools/gimphuesaturationtool.c
|
||
* app/tools/gimpimagemaptool.c
|
||
* app/tools/gimplevelstool.c: use GimpFrame widgets, changed spacings.
|
||
|
||
* app/widgets/gimptexteditor.c: tweaked.
|
||
|
||
2004-05-05 Jakub Steiner <jimmac@ximian.com>
|
||
|
||
* data/images/gimp_splash.png: ustable splash
|
||
|
||
2004-05-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/gui/menus.c: register a <Dock> UI manager which has all
|
||
action groups <Image> has except "view".
|
||
|
||
* app/widgets/gimpimagedock.[ch]: re-enabled the global shortcuts,
|
||
using UI manager instead of item factory. Unfortunately actions
|
||
without proxy widgets can't be activated so this change is pretty
|
||
useless. Oh well, will find a hack to work around this later...
|
||
|
||
2004-05-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimpblendoptions.c
|
||
* app/tools/gimpbucketfilloptions.c
|
||
* app/tools/gimpcoloroptions.c
|
||
* app/tools/gimpinkoptions.c
|
||
* app/tools/gimppaintoptions-gui.c
|
||
* app/tools/gimpselectionoptions.c
|
||
* app/tools/gimptooloptions-gui.c
|
||
* app/tools/gimptransformoptions.c: use GimpFrames where GtkFrame
|
||
was used. Put "Pressure Sensitivity" frame into a GtkExpander.
|
||
|
||
2004-05-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpframe.c: added a style property to control
|
||
boldening of the frame title.
|
||
|
||
* themes/Default/gtkrc
|
||
* themes/Small/gtkrc: suppress the bold title for GimpFrames in
|
||
GimpDockables,
|
||
|
||
2004-05-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpframe.c (gimp_frame_size_allocate): allocate
|
||
the full width for the label widget, looks better and is more
|
||
convenient to use with activatable widgets such as toggle buttons.
|
||
|
||
2004-05-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpfiledialog.c: removed debugging output, added
|
||
#warning about runtime version check that can be removed as soon
|
||
as we depend on GTK+ 2.4.1.
|
||
|
||
2004-05-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/file-dialog-actions.c (file_dialog_actions_setup):
|
||
don't forget to set the action's accelerator.
|
||
|
||
2004-05-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/actions/channels-commands.c
|
||
* app/actions/gradient-editor-commands.c
|
||
* app/actions/image-commands.c
|
||
* app/actions/layers-commands.c
|
||
* app/actions/qmask-commands.c
|
||
* app/actions/templates-commands.c
|
||
* app/actions/vectors-commands.c
|
||
* app/display/gimpdisplayshell-filter-dialog.c
|
||
* app/gui/convert-dialog.c
|
||
* app/gui/module-browser.c
|
||
* app/gui/offset-dialog.c
|
||
* app/gui/palette-import-dialog.c
|
||
* app/gui/resize-dialog.c
|
||
* app/gui/resolution-calibrate-dialog.c
|
||
* app/gui/tips-dialog.c
|
||
* app/gui/user-install-dialog.c
|
||
* app/widgets/gimpwidgets-utils.c
|
||
* libgimpwidgets/gimpquerybox.c: set dialog border spacing to 12.
|
||
|
||
2004-05-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/preferences-dialog.c
|
||
* app/widgets/widgets-enums.[ch]
|
||
* app/widgets/gimpwidgets-utils.c (gimp_window_set_hint): added
|
||
new window hint "keep-above" to force toolbox and/or dock windows
|
||
to be kept above (if the WM supports this hint). Fixes bug #131672.
|
||
|
||
2004-05-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
Fix bug #141719:
|
||
|
||
* app/tools/gimpmovetool.c (gimp_move_tool_motion): use RINT()
|
||
instead of ROUND() to round double coords to guide positions.
|
||
|
||
* app/display/gimpdisplayshell-callbacks.c
|
||
(gimp_display_shell_canvas_tool_events): pass RINT()-rounded
|
||
coords to gimp_display_shell_update_cursor() instead of implicitly
|
||
truncating by casting to int.
|
||
|
||
2004-05-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpundoeditor.c: removed code duplication by adding
|
||
utility function gimp_undo_editor_update_buttons(), some general
|
||
cleanups.
|
||
|
||
2004-05-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpimage.c (gimp_image_undo_freeze,thaw): emit the
|
||
"undo-freeze" and "undo-thaw" signals only on the first freeze and
|
||
last thaw, not on any of them.
|
||
|
||
* app/widgets/gimphelp-ids.h: added GIMP_HELP_EDIT_UNDO_CLEAR.
|
||
|
||
* app/widgets/gimpundoeditor.[ch]: added a "Clear Undo History"
|
||
button. Fixes bug #136300.
|
||
|
||
Also don't attach to the image's undo stack if the image's undo is
|
||
disabled and set the buttons' sensitivity accordingly. Should fix
|
||
all kinds of unpredictable undo history brokenness.
|
||
|
||
2004-05-04 Michael Natterer <mitch@gimp.org>
|
||
|
||
Treat FG/BG just like all other context properties:
|
||
|
||
* app/paint/gimppaintoptions.h: added GIMP_CONTEXT_FOREGROUND_MASK
|
||
and _BACKGROUND_MASK to GIMP_PAINT_OPTIONS_CONTEXT_MASK to specify
|
||
that they are used by GimpPaintOptions (automatically affects all
|
||
paint tools).
|
||
|
||
* app/tools/gimpblendtool.c
|
||
* app/tools/gimpbucketfilltool.c
|
||
* app/tools/gimpinktool.c: set FOREGROUND_MASK and BACKGROUND_MASK
|
||
manually here.
|
||
|
||
* app/tools/tool_manager.c (tool_manager_tool_changed): decide
|
||
about the globality of FG and BG at the same place where we decide
|
||
about the brush's, pattern's etc. globality, but hardcode them to
|
||
global = TRUE instead of looking at GimpConfig.
|
||
|
||
Fixes bug #141786.
|
||
|
||
2004-05-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/sobel.c (sobel_dialog): removed frame, adjusted
|
||
spacing, fixes bug #141773.
|
||
|
||
2004-05-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/stroke-dialog.c:
|
||
* app/widgets/gimpstrokeeditor.c: moved line style options into a
|
||
GtkExpander. Changed dialog spacings.
|
||
|
||
2004-05-03 Manish Singh <yosh@gimp.org>
|
||
|
||
* app/actions/qmask-actions.c: initialize is_active for qmask-toggle.
|
||
|
||
* app/actions/tools-actions.c: set entry help_id from tool_info,
|
||
since gimp_action_group_add_string_actions expects it to be there
|
||
now.
|
||
|
||
2004-05-03 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpframe.c (gimp_frame_new): added a hack that
|
||
allows to get the label_spacing but no label. Useful when the frame
|
||
is packed into a GtkExpander.
|
||
|
||
* app/widgets/gimptemplateeditor.c: pack the "Image Comment" frame
|
||
into a GtkExpander to reduce clutter and dialog size.
|
||
|
||
2004-05-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpwidgets/gimphelpui.[ch]: added gimp_help_id_quark()
|
||
which is G_GNUC_CONST and a new macro GIMP_HELP_ID as shortcut.
|
||
|
||
* app/widgets/gimpactiongroup.c (gimp_action_group_add_*_actions):
|
||
attach the help ID to the action using the new quark key. Call
|
||
gtk_action_group_add_action() instead of the _with_accel() variant
|
||
if the accel is the empty string (== if we explicitely want no
|
||
accel even if the stock item specifies one). Fixes warning flood
|
||
with GTK+ 2.4.1.
|
||
|
||
2004-05-03 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpframe.c: if the label_widget is a button, set
|
||
the button label as bold. Cache the indentation instead of
|
||
calculating it over and over again.
|
||
|
||
* themes/Default/gtkrc: set HIG-compliant spacing for the
|
||
action_area.
|
||
|
||
* app/widgets/gimppropwidgets.[ch]: added
|
||
gimp_prop_enum_radio_box_new() for a radio group that is no
|
||
embedded in a frame.
|
||
|
||
* app/widgets/gimpstrokeeditor.c: use a frame-less radio box for
|
||
the Stroke style.
|
||
|
||
* app/gui/file-new-dialog.c
|
||
* app/gui/grid-dialog.c
|
||
* app/gui/stroke-dialog.c: HIG-compliant spacings.
|
||
|
||
2004-05-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpdock.c (gimp_dock_key_press_event): new function
|
||
which overrides GtkWindow's default handler in order to give the
|
||
focus widget precedence over accelerators for keys without any
|
||
modifier or with <Shift> modifier. Enables e.g. having a <Shift>+s
|
||
accelerator while still being able to enter 'S' in an entry.
|
||
Thanks to Tim Janik for the code.
|
||
|
||
2004-05-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/actions.h. added the various return_if_no_foo()
|
||
macros here.
|
||
|
||
* app/actions/channels-commands.c
|
||
* app/actions/dialogs-commands.c
|
||
* app/actions/drawable-commands.c
|
||
* app/actions/edit-commands.c
|
||
* app/actions/file-commands.c
|
||
* app/actions/image-commands.c
|
||
* app/actions/layers-commands.c
|
||
* app/actions/qmask-commands.c
|
||
* app/actions/select-commands.c
|
||
* app/actions/vectors-commands.c
|
||
* app/actions/view-commands.c: removed them here. Some cleanup.
|
||
|
||
2004-05-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/actions.[ch]: added some utility functions to get a
|
||
Gimp, GimpImage, GimpDisplay and GtkWidget from the "data" pointer
|
||
passed to action callbacks.
|
||
|
||
* app/actions/channels-actions.c
|
||
* app/actions/channels-commands.c
|
||
* app/actions/drawable-actions.c
|
||
* app/actions/drawable-commands.c
|
||
* app/actions/edit-actions.c
|
||
* app/actions/edit-commands.c
|
||
* app/actions/file-actions.c
|
||
* app/actions/file-commands.c
|
||
* app/actions/help-commands.c
|
||
* app/actions/image-actions.c
|
||
* app/actions/image-commands.c
|
||
* app/actions/layers-actions.c
|
||
* app/actions/layers-commands.c
|
||
* app/actions/plug-in-actions.c
|
||
* app/actions/plug-in-commands.c
|
||
* app/actions/qmask-actions.c
|
||
* app/actions/qmask-commands.c
|
||
* app/actions/select-actions.c
|
||
* app/actions/select-commands.c
|
||
* app/actions/tools-commands.c
|
||
* app/actions/vectors-actions.c
|
||
* app/actions/vectors-commands.c
|
||
* app/actions/view-commands.c: use the new functions instead of
|
||
duplicating insane macros and if() constructs over and over again.
|
||
|
||
2004-05-03 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpwidgets.c: use a GimpFrame for
|
||
gimp_radio_group_new() and friends.
|
||
|
||
* themes/Default/gtkrc
|
||
* themes/Small/gtkrc: set a smaller label_spacing for GimpFrame
|
||
widgets in GimpDockables. Lame hack to keep the tool options
|
||
compact.
|
||
|
||
* app/actions/image-commands.c: changed spacing.
|
||
|
||
* app/gui/offset-dialog.c: merged check and radio buttons into a
|
||
single radio button group; changed spacing.
|
||
|
||
2004-05-03 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpframe.c (gimp_frame_size_allocate): respect
|
||
the frame's border width.
|
||
|
||
* app/widgets/gimpcolorframe.[ch]: derive from GimpFrame.
|
||
|
||
* app/gui/convert-dialog.c
|
||
* app/gui/info-window.c
|
||
* app/gui/palette-import-dialog.c
|
||
* app/gui/resize-dialog.c: use GimpFrames, changed some spacings.
|
||
|
||
2004-05-03 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/dockable-commands.c (dockable_add_tab_cmd_callback):
|
||
truncate the passed dialog identifier at the first '|'. Fixes
|
||
creating brushes, paterns etc. dialogs from the dockables'
|
||
"Add Tab" menu.
|
||
|
||
2004-05-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpframe.c (gimp_frame_size_request): take the
|
||
left margin into account.
|
||
|
||
* app/widgets/gimpgrideditor.c
|
||
* app/widgets/gimptemplateeditor.c: removed container borders that
|
||
aren't needed any longer.
|
||
|
||
2004-05-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpenumwidgets.c
|
||
* app/widgets/gimpgrideditor.c
|
||
* app/widgets/gimptemplateeditor.c: use the GimpFrame widget,
|
||
changed some spacings to better comply with the HIG.
|
||
|
||
2004-05-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/Makefile.am
|
||
* libgimpwidgets/gimpwidgets.h
|
||
* libgimpwidgets/gimpwidgetstypes.h
|
||
* libgimpwidgets/gimpframe.[ch]: added new widget GimpFrame, a HIG
|
||
compliant variant of GtkFrame.
|
||
|
||
* app/gui/preferences-dialog.c: enable the HIG compliant mode by
|
||
default and use the new GimpFrame widget for it.
|
||
|
||
* themes/Small/gtkrc: set a smaller spacing between the GimpFrame
|
||
title label and the frame content.
|
||
|
||
2004-05-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/qmask-actions.c: renamed action "qmask-toggle" to
|
||
"qmask-active" and added new action "qmask-toggle" with a label
|
||
and shortcut suited for the "Select" menu.
|
||
|
||
* app/actions/select-actions.c: removed "select-toggle-qmask".
|
||
|
||
* app/actions/select-commands.[ch]: removed callback
|
||
select_toggle_quickmask_cmd_callback().
|
||
|
||
* app/actions/channels-actions.c (channels_actions_update)
|
||
* app/actions/vectors-actions.c (vectors_actions_update): handle
|
||
"data" being both GimpDisplay and GimpDisplayShell so the actions
|
||
can be used in the image menu.
|
||
|
||
* menus/image-menu.xml.in: s/select-toggle-qmask/qmask-toggle/.
|
||
|
||
* menus/qmask-menu.xml: s/qmask-toggle/qmask-active/.
|
||
|
||
2004-05-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* menus/image-menu.xml.in
|
||
* menus/tool-options-menu.xml
|
||
* menus/toolbox-menu.xml.in: use empty elements for empty menus.
|
||
Makes the XML somewhat easier to read.
|
||
|
||
2004-05-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* menus/Makefile.am
|
||
* menus/dialogs-menuitems.xml: new file that holds menuitems that
|
||
appear in several places.
|
||
|
||
* menus/dockable-menu.xml.in: new file used to generate
|
||
dockable-menu.xml.
|
||
|
||
* menus/toolbox-menu.xml.in: new file used to generate
|
||
toolbox-menu.xml.
|
||
|
||
* menus/image-menu.xml.in: include dialogs-menuitems.xml.
|
||
|
||
* menus/menus.xsl: allow inclusion of menuitems using XInclude.
|
||
|
||
2004-05-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/Makefile.am
|
||
* app/actions/file-dialog-actions.[ch]: new files containing
|
||
factored out code to set up the <Load> and <Save> actions.
|
||
Use GimpPlugInActions instead of just GtkActions.
|
||
|
||
* app/actions/file-dialog-commands.[ch]: new files containing
|
||
file_dialog_type_cmd_callback() which is a
|
||
GimpPlugInAction::selected() callback now.
|
||
|
||
* app/actions/file-commands.[ch]: removed the callback here.
|
||
|
||
* app/actions/file-open-actions.c
|
||
* app/actions/file-save-actions.c: removed code duplication and
|
||
use file_dialog_actions_setup() instead.
|
||
|
||
2004-05-02 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/*-actions.c: added help IDs to all actions
|
||
representing the toplevel popups and menus (as fallbacks for the
|
||
still-to-be-written help system intrgration of GimpUIManager).
|
||
|
||
* app/display/gimpdisplayshell.c (gimp_display_shell_new): removed
|
||
call to gtk_ui_manager_ensure_update() because that's done by
|
||
gimp_ui_manager_ui_get() now.
|
||
|
||
* app/widgets/gimpmenufactory.[ch]: removed API to register and
|
||
create item factories.
|
||
|
||
* app/gui/menus.c: changed accordingly.
|
||
|
||
* app/gui/dialogs.c
|
||
* app/actions/plug-in-commands.c
|
||
* app/gui/file-dialog-utils.c
|
||
* app/gui/file-save-dialog.c
|
||
* app/widgets/gimpdataeditor.c
|
||
* app/widgets/gimpdockable.c
|
||
* app/widgets/gimpdockbook.[ch]
|
||
* app/widgets/gimpimagedock.c
|
||
* app/widgets/gimpitemtreeview.c: removed leftover item factory
|
||
cruft.
|
||
|
||
* app/widgets/widgets-types.h: removed item factory typedefs...
|
||
|
||
* app/widgets/gimpitemfactory.h: ...and added them here.
|
||
|
||
* app/widgets/gimpactiongroup.[ch]: added new function
|
||
gimp_action_group_add_plug_in_actions().
|
||
|
||
* app/actions/plug-in-actions.c: use it here instead of adding
|
||
the actions manually.
|
||
|
||
* app/widgets/gimptoolbox.c: ported the code which dynamically
|
||
updates the tool button tooltips on accelerator changes to
|
||
GtkAction. Disabled the whole stuff because GTK+ lacks
|
||
gtk_action_get_accel_closure().
|
||
|
||
2004-05-02 Sven Neumann <sven@gimp.org>
|
||
|
||
* menus/Makefile.am: added a rule to generate gtkuimanager XML
|
||
files using an XSL transformation.
|
||
|
||
* menus/menus.xsl: a simple XSLT to generate a menubar and a popup
|
||
menu with identical content.
|
||
|
||
* menus/image-menu.xml: removed this file from CVS ...
|
||
|
||
* menus/image-menu.xml.in: ... and added this instead.
|
||
|
||
* HACKING: xsltproc is now needed to build from CVS.
|
||
|
||
2004-05-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* configure.in: check for xmllint and xsltproc but don't require
|
||
these tools.
|
||
|
||
* menus/Makefile.am
|
||
* tips/Makefile.am: simplified "validate" targets.
|
||
|
||
2004-04-30 Pedro Gimeno <pggimeno@wanadoo.es>
|
||
|
||
* app/tools/gimprectselecttool.c: Cleanups.
|
||
(gimp_rect_select_tool_coords_to_integer): Undo my bogus fix for
|
||
bug #138103, which led to bug #140649.
|
||
|
||
* app/pdb/procedural_db.c (procedural_db_init_procs): Add missing
|
||
compat procs: gimp_channel_ops_duplicate, gimp_channel_ops_offset.
|
||
|
||
2004-04-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/tool-options-menu.c: added casts to please the compiler.
|
||
|
||
2004-04-30 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpuimanager.[ch]: added signal "update" which
|
||
is G_SIGNAL_RUN_LAST, so handlers can hook in before and after
|
||
the default implementation. Update the action groups
|
||
in the default implementations.
|
||
|
||
(gimp_ui_manager_ui_get): make sure we always return a widget
|
||
by calling gtk_ui_manager_ensure_update().
|
||
|
||
* app/widgets/gimpdockable.c (gimp_dockable_show_menu): make
|
||
sure the dockable menu is loaded before trying to access its
|
||
widgets/actions.
|
||
|
||
Resurrected the dynamic tool options menus:
|
||
|
||
* app/actions/tool-options-actions.c: dynamically destroy/create
|
||
actions for the tool options' presets.
|
||
|
||
* app/actions/tool-options-commands.[ch]: all callbacks are
|
||
GimpEnumAction::selected() callbacks now.
|
||
|
||
* app/gui/tool-options-menu.[ch]: connect and connect_after to
|
||
GimpUIManager::update(). Remove the old preset menu items
|
||
in the former callback, create the new ones in the latter.
|
||
Removed the last item factory entries.
|
||
|
||
* app/gui/menus.c
|
||
* app/widgets/gimptooloptionseditor.c: changed accordingly.
|
||
|
||
2004-04-29 Simon Budig <simon@gimp.org>
|
||
|
||
* app/main.c: when glibc is used, call mallopt, so that memory
|
||
chunks >= 4k (= 64*64 pixels, 1bpp - the smallest full tile)
|
||
get allocated via mmap. This ensures that after closing an image
|
||
the memory allocated for image data gets returned to the system.
|
||
|
||
Thanks to Phil Blundell <pb@nexus.co.uk> for bringing mallopt
|
||
to my attention.
|
||
|
||
Please watch closely for performance problems.
|
||
|
||
2004-04-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/Makefile.am
|
||
* app/actions/file-open-actions.[ch]
|
||
* app/actions/file-save-actions.[ch]: actions for the <Load> and
|
||
<Save> menus...
|
||
|
||
* menus/Makefile.am
|
||
* menus/file-open-menu.xml
|
||
* menus/file-save-menu.xml: ...and the menus.
|
||
|
||
* app/gui/file-open-menu.[ch]
|
||
* app/gui/file-save-menu.[ch]: ported to UI Manager.
|
||
|
||
* app/widgets/gimpfiledialog.[ch]: ditto.
|
||
|
||
* app/actions/actions.c
|
||
* app/gui/menus.c
|
||
* app/gui/file-open-dialog.c
|
||
* app/gui/file-save-dialog.c: changed accordingly.
|
||
|
||
* app/widgets/gimpuimanager.c: removed debugging code which
|
||
automatically loaded all registered menus. They are now loaded on
|
||
demand only.
|
||
|
||
2004-04-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
* libgimpbase/gimputils.[ch] (gimp_escape_uline): new function
|
||
which does the opposite of gimp_strip_uline().
|
||
|
||
* app/actions/file-actions.c (file_actions_last_opened_update):
|
||
escape ulines in filenames so they don't end up as mnemonics.
|
||
Spotted by Pedro Gimeno.
|
||
|
||
2004-04-29 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/pygimp/plug-ins/py-slice.py: Quick fix to make uppercase
|
||
tags work properly.
|
||
|
||
2004-04-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimp*tool.c (gimp_*_tool_register): stripped the menu
|
||
paths from the "menu_path". Will be renamed to "action_name" or
|
||
something soon...
|
||
|
||
* plug-ins/dbbrowser/dbbrowser.c
|
||
* plug-ins/common/plugindetails.c
|
||
* plug-ins/common/uniteditor.c: register under the new
|
||
"Extensions" placeholder.
|
||
|
||
2004-04-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
Switch from GtkItemFactory to GtkUIManager. The migration is
|
||
almost complete, still stuff missing/incomplete, definitely added
|
||
a bunch of new bugs...
|
||
|
||
* app/actions/*-commands.[ch]: converted all callback from
|
||
GtkItemFactory callbacks to GtkAction callbacks.
|
||
|
||
* app/actions/debug-actions.c
|
||
* app/actions/gradient-editor-actions.c
|
||
* app/actions/help-actions.c
|
||
* app/actions/plug-in-actions.c
|
||
* app/actions/qmask-actions.c
|
||
* app/actions/tool-options-actions.c: various fixes.
|
||
|
||
* app/display/gimpdisplay.[ch]
|
||
* app/display/gimpdisplayshell-appearance.[ch]
|
||
* app/display/gimpdisplayshell-callbacks.c
|
||
* app/display/gimpdisplayshell.[ch]: move everything from
|
||
GtkItemFactory to GtkUIManager.
|
||
|
||
* app/gui/dialogs.[ch]: added new function dialogs_get_toolbox().
|
||
Needed because the action callbacks don't have a widget parameter
|
||
and sometimes we need a parent window for showing dialogs.
|
||
|
||
* app/gui/Makefile.am
|
||
* app/gui/brushes-menu.[ch]
|
||
* app/gui/buffers-menu.[ch]
|
||
* app/gui/channels-menu.[ch]
|
||
* app/gui/colormap-editor-menu.[ch]
|
||
* app/gui/dialogs-menu.[ch]
|
||
* app/gui/documents-menu.[ch]
|
||
* app/gui/error-console-menu.[ch]
|
||
* app/gui/fonts-menu.[ch]
|
||
* app/gui/gradient-editor-menu.[ch]
|
||
* app/gui/gradients-menu.[ch]
|
||
* app/gui/images-menu.[ch]
|
||
* app/gui/layers-menu.[ch]
|
||
* app/gui/palette-editor-menu.[ch]
|
||
* app/gui/palettes-menu.[ch]
|
||
* app/gui/patterns-menu.[ch]
|
||
* app/gui/qmask-menu.[ch]
|
||
* app/gui/templates-menu.[ch]
|
||
* app/gui/vectors-menu.[ch]: removed these files.
|
||
|
||
* app/gui/gui.c: create a global UI manager for the image popup
|
||
menu and the toolbox menubar.
|
||
|
||
* app/gui/menus.[ch]: removed all GtkItemFactory code.
|
||
|
||
* app/gui/image-menu.[ch]
|
||
* app/gui/toolbox-menu.[ch]: removed everything except the trivial
|
||
setup_funcs.
|
||
|
||
* app/gui/file-open-menu.c
|
||
* app/gui/file-save-menu.c
|
||
* app/gui/tool-options-menu.c: don't use the macros from menus.h
|
||
any more, they are gone.
|
||
|
||
* app/gui/gui-vtable.c
|
||
* app/gui/plug-in-menus.[ch]: create/destroy the dynamic plug-in
|
||
menu entries.
|
||
|
||
* app/tools/gimpimagemaptool.c: s/gimp_item_factory_update/
|
||
gimp_ui_manager_update/g
|
||
|
||
* app/widgets/gimpuimanager.[ch]: added API to get an action
|
||
group by name.
|
||
|
||
* app/widgets/gimpmenufactory.c: don't choke on the item_factory
|
||
entries being NULL.
|
||
|
||
* app/widgets/gimpactiongroup.c: make sure booleans set using
|
||
g_object_set() only have TRUE or FALSE values.
|
||
|
||
* app/widgets/gimpcolormapeditor.c
|
||
* app/widgets/gimpcomponenteditor.c
|
||
* app/widgets/gimpcontainereditor.[ch]
|
||
* app/widgets/gimpcontainergridview.c
|
||
* app/widgets/gimpcontainertreeview.c
|
||
* app/widgets/gimpdockable.[ch]
|
||
* app/widgets/gimpdocked.[ch]
|
||
* app/widgets/gimpeditor.[ch]
|
||
* app/widgets/gimperrorconsole.c
|
||
* app/widgets/gimpgradienteditor.c
|
||
* app/widgets/gimpitemtreeview.c
|
||
* app/widgets/gimppaletteeditor.c
|
||
* app/widgets/gimptoolbox.c
|
||
* app/widgets/gimptooloptionseditor.c: removed all GtkItemFactory
|
||
code and enable the #if 0'ed UI manager stuff.
|
||
|
||
* menus/gradient-editor-menu.xml: fixed typos.
|
||
|
||
* menus/image-menu.xml: duplicate everything so we have both
|
||
an image menubar and an image popup menu. Badly cries for an
|
||
XSL processor.
|
||
|
||
* menus/toolbox-menu.xml: added an "Extensions" placeholder.
|
||
|
||
2004-04-27 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimppluginaction.[ch]: new GtkAction subclass which
|
||
remembers the PlugInProcDef.
|
||
|
||
* app/widgets/gimpactiongroup.[ch]: added "gpointer user_data" to
|
||
the GimpActionGroup struct and to gimp_action_group_new(). Removed
|
||
the user_data parameter from gimp_action_group_add_*_actions().
|
||
|
||
* app/widgets/gimpactionfactory.[ch]: changed accordingly.
|
||
|
||
* app/actions/*-actions.[ch]: removed user_data from all setup_funcs.
|
||
|
||
* app/actions/plug-in-actions.c: use a GimpPlugInAction and
|
||
finally use the right user_data for the callback so plug-in
|
||
callbacks have a proper context.
|
||
|
||
* app/gui/plug-in-menus.[ch]: renamed plug_in_menus_create2() to
|
||
plug_in_menus_setup().
|
||
|
||
* app/gui/image-menu.c
|
||
* app/gui/toolbox-menu.c: changed accordingly.
|
||
|
||
2004-04-27 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpactiongroup.[ch]: removed "translation-domain"
|
||
property and simply use gettext(). Plug-In domains are handled
|
||
by plug-in-actions.c
|
||
|
||
The following change finally starts breaking the old menu system
|
||
while the new one is not fully in place yet. Have fun:
|
||
|
||
* menus/image-menu.xml: added several <placeholder>s for plug-ins
|
||
to register their menu entries in the middle of already existing
|
||
menus.
|
||
|
||
* app/gui/menus.c
|
||
* plug-ins/common/mail.c
|
||
* plug-ins/print/print.c
|
||
* plug-ins/script-fu/scripts/copy-visible.scm: use the new
|
||
placeholders to register menu entries.
|
||
|
||
2004-04-27 Michael Natterer <mitch@gimp.org>
|
||
|
||
Correctly translated & sorted plug-in actions & menu entries:
|
||
|
||
* app/widgets/gimpuimanager.[ch]: added a "gchar *name" property
|
||
and a hash table which keeps all created UI managers (similar to
|
||
GimpActionGroup's hash table). Added function
|
||
gimp_ui_managers_from_name() which returns a list of all managers
|
||
with the given name.
|
||
|
||
* app/widgets/gimpmenufactory.c: register a name per UI manager
|
||
and pass the name to gimp_ui_manager_new().
|
||
|
||
* app/actions/plug-in-actions.c: added code which correctly
|
||
translates the created plug-in actions and also creates translated
|
||
menu actions for the plug-in's menu_path elements.
|
||
|
||
* app/gui/plug-in-menus.[ch]: sort the plug-ins' menu entries
|
||
using a GTree. For each entry, recursivlely create submenus
|
||
from the dynamic menu actions created above before creating
|
||
the plug-in's menu entry itself.
|
||
|
||
* app/gui/image-menu.c (image_menu_setup2)
|
||
* app/gui/toolbox-menu.c (toolbox_menu_setup2): call
|
||
plug_in_menus_create2().
|
||
|
||
* app/gui/gui-vtable.c (gui_menus_create_entry)
|
||
(gui_menus_delete_entry): added some uglyness which maps old <Prefix>
|
||
menu identifiers to new-style UI manager plus ui_path tuples and
|
||
call plug_in_menus_add,remove_proc() accordingly.
|
||
|
||
* menus/image-menu.xml
|
||
* menus/toolbox-menu.xml: added name="Foo" attributes to all menus
|
||
so plug-in entries find their place.
|
||
|
||
2004-04-27 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/gui/gui.c (gui_restore_callback): call actions_init()
|
||
(gui_exit_after_callback): call actions_exit().
|
||
|
||
* app/gui/menus.c (menus_init)
|
||
(menu_exit): don't call them here.
|
||
|
||
2004-04-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/widgets-types.h: added GimpUIManagerSetupFunc typedef.
|
||
|
||
* app/widgets/gimpuimanager.[ch]: added the setup_func to the
|
||
GimpUIManagerUIEntry struct and to gimp_ui_manager_ui_register().
|
||
Call the setup_func after creating the UI. Replaced the term
|
||
"identifier" by "ui_path".
|
||
|
||
* app/widgets/gimpmenufactory.c: ditto.
|
||
|
||
* app/gui/menus.c (menus_init): register the new setup_funcs below.
|
||
|
||
* app/gui/menus.[ch] (menus_open_recent_add)
|
||
* app/gui/image-menu.[ch] (image_menu_setup2)
|
||
* app/gui/toolbox-menu.[ch] (toolbox_menu_setup2): new setup_funcs
|
||
which add the "Open Recent" menu items.
|
||
|
||
* app/actions/file-actions.c: removed "file-open-recent-empty"
|
||
action because it's not needed.
|
||
|
||
* menus/image-menu.xml
|
||
* menus/toolbox-menu.xml: removed "file-open-recent-empty" menu
|
||
items and added <placeholder>s for the "Open Recent" menu items.
|
||
|
||
2004-04-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimp.[ch]: removed "locale_domain" and "help_domain"
|
||
parameters from GimpMenusCreateFunc.
|
||
|
||
* app/plug-in/plug-ins.c (plug_ins_temp_proc_def_add)
|
||
* app/actions/plug-in-actions.[ch] (plug_in_actions_add_proc_def):
|
||
changed accordingly.
|
||
|
||
* app/widgets/gimpactiongroup.[ch]: remember all created action
|
||
groups is a hash table in GimpActionGroupClass. Added
|
||
gimp_action_groups_from_name() which returns a GList of all groups
|
||
with the given name.
|
||
|
||
* app/actions/plug-in-actions.[ch] (plug_in_actions_setup):
|
||
removed the tree sorting code. Actions don't need to be ordered
|
||
alphabetically.
|
||
|
||
(plug_in_actions_update): copied & ported plug_in_menus_update().
|
||
|
||
* app/gui/gui-vtable.c (gui_menus_create,delete_entry):
|
||
dynamically add/remove plug-in actions in all "plug-in" action
|
||
groups.
|
||
|
||
2004-04-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimp.[ch]: changed GimpMenusDeleteFunc to take
|
||
a PlugInProcDef* instead of a const gchar*.
|
||
|
||
* app/plug-in/plug-ins.c
|
||
* app/gui/gui-vtable.c
|
||
* app/gui/plug-in-menus.[ch]: changed accordingly.
|
||
|
||
2004-04-25 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/AlienMap2.c: some UI improvements based on a
|
||
patch by William Skaggs (bug #140079).
|
||
|
||
2004-04-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/dialogs-constructors.c
|
||
* app/gui/preferences-dialog.c: silent the compiler.
|
||
|
||
* plug-ins/winicon/icodialog.c: simplified by using a
|
||
GimpIntComboBox.
|
||
|
||
2004-04-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpuimanager.[ch]: remember and ref the created
|
||
widgets. Added gimp_ui_manager_ui_popup() which pops up a GtkMenu
|
||
with a custom GimpMenuPositionFunc and a GtkDestroyNotify which is
|
||
called on popdown.
|
||
|
||
* app/widgets/gimpmenufactory.c (gimp_menu_factory_finalize):
|
||
don't forget to free the list of managed UIs.
|
||
|
||
* app/widgets/gimpdockable.[ch]
|
||
* app/widgets/gimpdockbook.[ch]
|
||
* app/widgets/gimpdocked.[ch]
|
||
* app/widgets/gimpeditor.[ch]: added GimpUIManager stuff parallel
|
||
to the to-be-removed GtkItemFactory stuff.
|
||
|
||
* app/widgets/gimpcolormapeditor.c
|
||
* app/widgets/gimpcomponenteditor.c
|
||
* app/widgets/gimpcontainereditor.c
|
||
* app/widgets/gimpcontainergridview.c
|
||
* app/widgets/gimpcontainertreeview.c
|
||
* app/widgets/gimperrorconsole.c
|
||
* app/widgets/gimpgradienteditor.c
|
||
* app/widgets/gimpitemtreeview.c
|
||
* app/widgets/gimppaletteeditor.c
|
||
* app/widgets/gimptooloptionseditor.c: changed accordingly and added
|
||
#if 0'ed code which actually uses all the UI managers.
|
||
|
||
* app/display/gimpdisplay.c
|
||
* app/display/gimpdisplayshell.c
|
||
* app/gui/gui-vtable.c: disabled some gimp_ui_manager_update()
|
||
calls because they were invoking toggle and radio callbacks
|
||
which still have the wrong signature.
|
||
|
||
2004-04-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gflare/gflare.c: ported the last plug-in from
|
||
GtkOptionMenu to GimpIntComboBox.
|
||
|
||
* plug-ins/common/newsprint.c: changed a comment that was still
|
||
talking about option menus.
|
||
|
||
2004-04-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/gui/menus.c (menus_init): fixed some typos in the UI Manager
|
||
registration code.
|
||
|
||
2004-04-22 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpactiongroup.[ch]: implemented
|
||
gimp_action_group_set_action_color() and
|
||
gimp_action_group_set_action_viewable().
|
||
|
||
* app/actions/*-actions.c: added stock IDs to all actions which
|
||
represent toplevel popup menus. Fixed typos.
|
||
|
||
* menus/brushes-menu.xml
|
||
* menus/colormap-editor-menu.xml
|
||
* menus/dockable-menu.xml
|
||
* menus/gradients-menu.xml
|
||
* menus/patterns-menu.xml
|
||
* menus/toolbox-menu.xml: fixed typos.
|
||
|
||
2004-04-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/rcm/rcm_callback.[ch]
|
||
* plug-ins/rcm/rcm_dialog.c: ported from GtkOptionMenu to
|
||
GimpIntComboBox.
|
||
|
||
2004-04-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpintstore.[ch]: automatically add an "(Empty)"
|
||
item if the store is empty and remove it as soon as other items
|
||
are being added.
|
||
|
||
* libgimp/gimpdrawablecombobox.c
|
||
* libgimp/gimpimagecombobox.c: removed handling of the empty list;
|
||
the store does this for us now.
|
||
|
||
2004-04-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpintcombobox.c (gimp_int_combo_box_new):
|
||
removed the check for first_label != NULL. Passing a NULL label
|
||
makes a perfect empty combo_box.
|
||
|
||
* plug-ins/common/newsprint.c
|
||
* plug-ins/common/spheredesigner.c: ported from GtkOptioMenu to
|
||
GimpIntComboBox.
|
||
|
||
2004-04-22 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/flame/flame.c
|
||
* plug-ins/gimpressionist/brush.c: ported the last two users of
|
||
gimpmenu.h to GimpDrawableComboBox.
|
||
|
||
* libgimp/gimpmenu.[ch]: declared the functions found here as
|
||
deprecated.
|
||
|
||
* plug-ins/common/plugindetails.c
|
||
* plug-ins/ifscompose/ifscompose.c: silent the compiler.
|
||
|
||
2004-04-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpdrawablecombobox.c
|
||
* libgimp/gimpimagecombobox.c
|
||
* libgimp/gimpmenu.c: changed the label for the empty menu from
|
||
"None" to "Empty" since that's what GTK+ uses.
|
||
|
||
* libgimpwidgets/gimpintcombobox.[ch]: added convenience function
|
||
gimp_int_combo_box_connect().
|
||
|
||
* plug-ins/common/bumpmap.c
|
||
* plug-ins/common/compose.c
|
||
* plug-ins/common/depthmerge.c
|
||
* plug-ins/common/displace.c
|
||
* plug-ins/common/lic.c
|
||
* plug-ins/common/warp.c: ported to GimpDrawableComboBox.
|
||
|
||
* plug-ins/Lighting/lighting_ui.c
|
||
* plug-ins/MapObject/mapobject_ui.c
|
||
* plug-ins/common/sample_colorize.c: use
|
||
gimp_int_combo_box_connect(). This restores the correct behaviour
|
||
of setting the drawable_ID to the first drawable from the list if
|
||
it's invalid.
|
||
|
||
2004-04-21 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpuimanager.[ch]: new GtkUIManager subclass. Adds
|
||
API to update all action groups and knows which UIs it can create
|
||
from which XML files.
|
||
|
||
* app/widgets/gimpmenufactory.[ch]: register the XML file
|
||
basenames along with path of their toplevel menus. Create
|
||
GimpUIManagers instead of GtkUIManagers and register the
|
||
XML files and menu paths with them.
|
||
|
||
* app/gui/menus.c: register all XML files and their toplevel
|
||
menu paths.
|
||
|
||
* app/widgets/gimpeditor.[ch]: also create a GimpUIManager when
|
||
creating the GtkItemFactory. Added "const gchar *ui_identifier"
|
||
parameter to gimp_editor_create_menu().
|
||
|
||
* app/widgets/gimpcontainereditor.[ch]
|
||
* app/widgets/gimpdataeditor.[ch]
|
||
* app/widgets/gimpdatafactoryview.[ch]
|
||
* app/widgets/gimpitemtreeview.[ch]: added "ui_identifier"
|
||
parameters to all constructors.
|
||
|
||
* app/widgets/gimpbrusheditor.c
|
||
* app/widgets/gimpbrushfactoryview.c
|
||
* app/widgets/gimpbufferview.c
|
||
* app/widgets/gimpcolormapeditor.c
|
||
* app/widgets/gimpcomponenteditor.c
|
||
* app/widgets/gimpcontainerpopup.c
|
||
* app/widgets/gimpdocumentview.c
|
||
* app/widgets/gimperrorconsole.c
|
||
* app/widgets/gimpfontview.c
|
||
* app/widgets/gimpgradienteditor.c
|
||
* app/widgets/gimpimageview.c
|
||
* app/widgets/gimppaletteeditor.c
|
||
* app/widgets/gimppatternfactoryview.c
|
||
* app/widgets/gimptemplateview.c
|
||
* app/widgets/gimptooloptionseditor.c
|
||
* app/gui/dialogs-constructors.c
|
||
* app/gui/gradient-select.c
|
||
* app/gui/palette-select.c
|
||
* app/gui/pattern-select.c: pass UI identifiers to the changed
|
||
functions above.
|
||
|
||
* app/display/gimpdisplayshell.[ch]: added a GimpUIManager for
|
||
the menubar (menubar creating code still commented out).
|
||
|
||
* app/display/gimpdisplay.c
|
||
* app/gui/gui-vtable.c: update the ui manager.
|
||
|
||
2004-04-21 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/actions.c: forgot to register the "patterns" actions.
|
||
|
||
* app/actions/*-actions.c: added actions representing the toplevel
|
||
menus (popups and menubars). Fixed some typos.
|
||
|
||
* menus/*-menu.xml: added action="foo" attributes to all toplevel
|
||
menus. Fixed typos here too.
|
||
|
||
* menus/gtkuimanager.dtd: fixed possible attributes.
|
||
|
||
2004-04-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpmenu.c (gimp_menu_add_none): use the same label as
|
||
in the new combo_box widgets.
|
||
|
||
* libgimpwidgets/gimpintcombobox.[ch]
|
||
* libgimpwidgets/gimpintstore.[ch]: use LibGIMP copyright headers.
|
||
|
||
2004-04-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/gimpdrawablecombobox.c
|
||
* libgimp/gimpimagecombobox.c
|
||
* libgimp/gimppixbuf.c
|
||
* libgimpwidgets/gimpintcombobox.c
|
||
* libgimpwidgets/gimpintstore.c: API documentation.
|
||
|
||
2004-04-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpintcombobox.[ch]: added new functions
|
||
gimp_int_combo_box_[prepend|append].
|
||
|
||
* plug-ins/common/sample_colorize.c: ported to GimpDrawableComboBox.
|
||
|
||
2004-04-21 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/qmask-actions.c
|
||
* app/actions/qmask-commands.c: prepared qmask_actions_update()
|
||
and the qmask callbacks to be merged into the image ui manager.
|
||
|
||
* app/actions/dialogs-actions.c
|
||
* app/actions/edit-actions.c
|
||
* app/actions/file-actions.c
|
||
* app/actions/image-actions.c
|
||
* app/actions/layers-actions.c
|
||
* app/actions/plug-in-actions.c
|
||
* app/actions/tools-actions.c
|
||
* app/actions/view-actions.c: fixed lots of typos and buglets
|
||
spotted in my first test run.
|
||
|
||
* app/gui/menus.c: register the needed action groups with the
|
||
<Image> menu.
|
||
|
||
* app/tools/gimp-tools.c
|
||
* app/tools/gimpdodgeburntool.[ch]
|
||
* app/tools/gimppaintoptions-gui.c: s/dodgeburn/dodge_burn/g.
|
||
|
||
* app/widgets/gimpactionfactory.c
|
||
* app/widgets/gimpmenufactory.[ch]: s/G_GNUC_FUNCTION/G_STRFUNC/g,
|
||
updated copyright header.
|
||
|
||
* menus/image-menu.xml: fixed typos and added the "Filters"
|
||
submenus.
|
||
|
||
2004-04-21 Michael Natterer <mitch@gimp.org>
|
||
|
||
More unused action stuff:
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpactionfactory.[ch]: added a simple factory which
|
||
produces GimpActionGroups.
|
||
|
||
* app/widgets/gimpactiongroup.[ch]: added an "update_func" member
|
||
to the GimpActionGroup struct. Added it as parameter to
|
||
gimp_action_group_new(). Added function gimp_action_group_update().
|
||
|
||
* app/widgets/gimpmenufactory.[ch]: added an "action_factory"
|
||
member and constructor parameter. Added code to create
|
||
GtkUIManagers from registered action group identifiers.
|
||
|
||
* app/actions/Makefile.am
|
||
* app/actions/actions.[ch]: new files: create a
|
||
"global_action_factory" and register all action groups with it.
|
||
|
||
* app/actions/edit-actions.c: s/edit_action_update/edit_actions_update/
|
||
|
||
* app/actions/plug-in-actions.[ch]: added API to add/remove
|
||
plug-in procedure actions dynamically (unfinished).
|
||
|
||
* app/gui/menus.c (menus_init): call actions_init().
|
||
(menus_exit): call actions_exit().
|
||
|
||
2004-04-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/Lighting/lighting_ui.c
|
||
* plug-ins/MapObject/mapobject_ui.c: ported to the new API.
|
||
|
||
2004-04-21 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimp/Makefile.am
|
||
* libgimp/gimpui.h
|
||
* libgimp/gimppixbuf.[ch]: new file that holds pixbuf accessors
|
||
to gimp data (drawable and image thumbnails for now).
|
||
|
||
* libgimp/gimpdrawablecombobox.[ch]
|
||
* libgimp/gimpimagecombobox.[ch]: new files with GimpIntComboBox
|
||
constructors for image, drawable, channel and layer menus.
|
||
|
||
* plug-ins/script-fu/script-fu-scripts.c: use the new functions
|
||
instead of the gimpmenu API that is about to be deprecated.
|
||
|
||
2004-04-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/pdbgen/pdb/fileops.pdb (file_load_thumbnail): removed
|
||
color cast. Merged from stable branch.
|
||
|
||
* app/pdb/fileops_cmds.c: regenerated.
|
||
|
||
2004-04-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/Makefile.am
|
||
* libgimpwidgets/gimpwidgets.h
|
||
* libgimpwidgets/gimpwidgetstypes.h
|
||
* libgimpwidgets/gimpintstore.[ch]: added a GimpIntStore, derived
|
||
from GtkListStore, to be used by GimpIntComboBox and also by the
|
||
image and drawable menus.
|
||
|
||
* libgimpwidgets/gimpintcombobox.c: use the new GimpIntStore.
|
||
|
||
* app/widgets/gimpenumstore.[ch]: derive from GimpIntStore,
|
||
removed API that is provided by the parent class.
|
||
|
||
* app/widgets/gimpenumcombobox.[ch]: derive from GimpIntComboBox,
|
||
removed API that is provided by the parent class.
|
||
|
||
* app/gui/resize-dialog.c
|
||
* app/tools/gimpcurvestool.c
|
||
* app/tools/gimplevelstool.c
|
||
* app/widgets/gimpcolorframe.c
|
||
* app/widgets/gimphistogrameditor.c
|
||
* app/widgets/gimppropwidgets.c
|
||
* app/widgets/gimpstrokeeditor.c: changed accordingly.
|
||
|
||
2004-04-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpenumstore.[ch]
|
||
* app/widgets/gimpenumcombobox.c: let the pixbuf renderer take care
|
||
of rendering the pixbuf from the stock_id.
|
||
|
||
2004-04-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/gimpmemsizeentry.c
|
||
* modules/cdisplay_colorblind.c
|
||
* modules/cdisplay_proof.c: ported to GimpIntComboBox.
|
||
|
||
* libgimpwidgets/gimpwidgets.[ch]: declared the gimp option_menu
|
||
API as deprecated and removed the code here.
|
||
|
||
* libgimpwidgets/Makefile.am
|
||
* libgimpwidgets/gimpoldwidgets.[ch]: new files with deprecated
|
||
code, guarded with #ifndef GIMP_DISABLE_DEPRECATED ... #endif.
|
||
|
||
* libgimpwidgets/gimpintcombobox.h: added G_BEGIN_DECLS, G_END_DECLS.
|
||
|
||
* configure.in (CPP_FLAGS): added -DGIMP_DISABLE_DEPRECATED.
|
||
|
||
* app/widgets/gimpwidgets-constructors.c: added a #warning and
|
||
#undef GIMP_DISABLE_DEPRECATED. The paint mode menu is the last
|
||
remaining user of gimp_int_option_menu_new().
|
||
|
||
2004-04-20 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/gui/convert-dialog.[ch]: renamed convert_to_indexed()
|
||
to convert_dialog_new() and return the dialog. Removed
|
||
convert_to_rgb() and convert_to_grayscale().
|
||
|
||
* app/gui/offset-dialog.[ch]: renamed offset_dialog_create()
|
||
to offset_dialog_new() and return the dialog.
|
||
|
||
* app/Makefile.am
|
||
* app/actions/drawable-commands.c
|
||
* app/actions/image-commands.c: changed accordingly.
|
||
|
||
2004-04-20 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/gui/*-commands.[ch]: removed...
|
||
|
||
* app/actions/*-commands.[ch]: ...and added here.
|
||
|
||
* app/gui/Makefile.am
|
||
* app/gui/*-menu.c
|
||
* app/gui/dialogs-constructors.c
|
||
* app/gui/gui.c
|
||
* app/gui/menus.c
|
||
* app/actions/Makefile.am
|
||
* app/actions/*-actions.c: changed accordingly.
|
||
|
||
* app/actions/plug-in-actions.[ch]
|
||
* app/actions/tools-actions.[ch]: new files.
|
||
|
||
* app/Makefile.am: had to add more -u evilness because gui/
|
||
and actions/ have cyclic dependencies.
|
||
|
||
* menus/image-menu.xml: added some more items.
|
||
|
||
2004-04-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpwidgets-constructors.[ch]: added new function
|
||
gimp_paint_mode_menu_set_history().
|
||
|
||
* app/gui/brush-select.c
|
||
* app/widgets/gimplayertreeview.c
|
||
* app/widgets/gimppropwidgets.c: use the new function instead of
|
||
the deprecated gimp_int_option_menu API.
|
||
|
||
2004-04-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/align_layers.c
|
||
* plug-ins/common/borderaverage.c
|
||
* plug-ins/common/channel_mixer.c
|
||
* plug-ins/common/gif.c
|
||
* plug-ins/common/mng.c
|
||
* plug-ins/flame/flame.c
|
||
* plug-ins/gfig/gfig.c: ported remaining plug-ins to GimpIntComboBox.
|
||
|
||
2004-04-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/iwarp.c (iwarp_get_pixel): check tile != NULL
|
||
before unrefing it. Fixes bug #140554; merged from stable branch.
|
||
|
||
2004-04-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpenumcombobox.c: added more sanity checks.
|
||
|
||
* libgimpwidgets/gimpintcombobox.[ch]: added another GimpIntComboBox
|
||
constructor: gimp_int_combo_box_new_array().
|
||
|
||
* plug-ins/Lighting/lighting_ui.c
|
||
* plug-ins/MapObject/mapobject_ui.c
|
||
* plug-ins/common/CML_explorer.c: ported to GimpIntComboBox.
|
||
|
||
2004-04-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpwidgets/Makefile.am
|
||
* libgimpwidgets/gimpwidgets.h
|
||
* libgimpwidgets/gimpwidgetstypes.h
|
||
* libgimpwidgets/gimpintcombobox.[ch]: added new widget
|
||
GimpIntComboBox, a GtkComboBox with a simple list store to hold a
|
||
label and an associated integer value. This is going to replace
|
||
gimp_int_option_menu.
|
||
|
||
* plug-ins/common/jpeg.c
|
||
* plug-ins/print/gimp_main_window.c: ported these two plug-ins to
|
||
the newly added widget.
|
||
|
||
2004-04-20 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/gfig/gfig.c: removed unused return locations for menu
|
||
item pointers.
|
||
|
||
2004-04-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* configure.in: set gimp_plugin_version, gimp_sysconf_version and
|
||
gimp_data_version to 2.1 so that the development version is
|
||
clearly separated from stable gimp 2.0.
|
||
|
||
2004-04-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* menus/Makefile.am
|
||
* menus/image-menu.xml
|
||
* menus/tool-options-menu.xml: more menus.
|
||
|
||
2004-04-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpactiongroup.c
|
||
* app/widgets/gimpenumcombobox.c
|
||
* app/widgets/gimpenumstore.c: fixed inline docs.
|
||
|
||
* app/widgets/gimpenumaction.c: fixed property declaration.
|
||
|
||
2004-04-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/gui/colormap-editor-commands.[ch]
|
||
* app/gui/debug-commands.[ch]
|
||
* app/gui/dockable-commands.[ch]
|
||
* app/gui/error-console-commands.[ch]
|
||
* app/gui/file-commands.[ch]
|
||
* app/gui/gradient-editor-commands.[ch]
|
||
* app/gui/help-commands.[ch]
|
||
* app/gui/qmask-commands.[ch]
|
||
* app/gui/tool-options-commands.[ch]: removed "guint action"
|
||
parameter from all callbacks which don't need it.
|
||
|
||
2004-04-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* menus/Makefile.am
|
||
* menus/gtkuimanager.dtd: added a DTD (basically copied from the
|
||
GTK+ API docs). Added a "validate" rule that allows to easily
|
||
validate the XML files.
|
||
|
||
* menus/*.xml: added a DOCTYPE declaration that refers to the
|
||
newly added DTD.
|
||
|
||
* app/widgets/gimpenumstore.[ch]:
|
||
* app/widgets/gimpenumcombobox.c: documented the new API.
|
||
|
||
2004-04-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/actions/Makefile.am
|
||
* app/actions/actions-types.h: oops, forgot to commit this one.
|
||
|
||
2004-04-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
* menus/Makefile.am
|
||
* menus/toolbox-menu.xml: added the toolbox menu.
|
||
|
||
2004-04-19 Michael Natterer <mitch@gimp.org>
|
||
|
||
More GtkAction stuff (still unused):
|
||
|
||
* configure.in: added new directories menus/ and app/actions/
|
||
|
||
* Makefile.am: build menus/
|
||
|
||
* menus/.cvsignore
|
||
* menus/Makefile.am
|
||
* menus/*-menu.xml: new files: XML menu descriptions for each menu
|
||
which is now defined in gui/*-menu.c.
|
||
|
||
* app/widgets/widgets-types.h: some typedefs for GimpActionGroup.
|
||
|
||
* app/widgets/gimpactiongroup.[ch]: added a "Gimp" construct-only
|
||
property. Added APIs to set actions visible/sensitive/active
|
||
and an unimplemented stub for setting the action's color.
|
||
|
||
* app/Makefile.am: build actions/ and link libappactions.a
|
||
|
||
* app/actions/.cvsignore
|
||
* app/actions/Makefile.am
|
||
* app/actions/*-actions.[ch]: new files: GtkActions for each
|
||
*-commands.c file in gui/. Ported all "update" functions from the
|
||
*-menu.c files.
|
||
(everything completely unused, untested and partly #if 0'ed)
|
||
|
||
* app/core/gimpimage.[ch]: for reasons of (action-) symmetry, added
|
||
API to raise/lower channels/vectors to top/bottom.
|
||
|
||
* app/gui/channels-commands.[ch]
|
||
* app/gui/vectors-commands.[ch]: added callbacks for the new
|
||
to top/bottom functions.
|
||
|
||
* app/gui/Makefile.am
|
||
* app/gui/dockable-commands.[ch]: new files split out of
|
||
dialogs-commands.[ch].
|
||
|
||
* app/gui/dialogs-commands.[ch]
|
||
* app/gui/dialogs-menu.c: changed accordingly.
|
||
|
||
* app/gui/edit-commands.[ch]: added edit_paste_into_cmd_callback()
|
||
and remove usage of "guint action".
|
||
|
||
* app/gui/image-menu.c: changed accordingly.
|
||
|
||
* app/gui/palette-editor-commands.[ch]: split
|
||
+palette_editor_new_color_cmd_callback() into separate callbacks
|
||
for adding from FG and BG.
|
||
|
||
* app/gui/palette-editor-menu.c: changed accordingly.
|
||
|
||
2004-04-19 Henrik Brix Andersen <brix@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/gimp-headers.scm
|
||
* plug-ins/script-fu/scripts/gimp-labels.scm: applied a patch from
|
||
William Skaggs which changes the sub menu title for the gimp web
|
||
theme to classic.gimp.org. Fixes bug #137036.
|
||
|
||
2004-04-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpdrawabletreeview.c: removed unused includes.
|
||
|
||
2004-04-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimppropwidgets.[ch]
|
||
* app/gui/preferences-dialog.c: replaced
|
||
gimp_prop_boolean_option_menu_new() with
|
||
gimp_prop_boolean_combo_box_new().
|
||
|
||
2004-04-19 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpenumstore.[ch]: avoid unnecessary casts.
|
||
|
||
* app/widgets/gimpenumcombobox.[ch]: added an API that inserts a
|
||
GtkTreeModelFilter to make items invisible. This is a kludge to
|
||
workaround bug #135875.
|
||
|
||
* app/tools/gimpcurvestool.c
|
||
* app/tools/gimplevelstool.c
|
||
* app/widgets/gimphistogrameditor.c: use the new function to hide
|
||
channels that are not available.
|
||
|
||
2004-04-18 Henrik Brix Andersen <brix@gimp.org>
|
||
|
||
* app/widgets/gimptemplateeditor.c
|
||
(gimp_template_editor_constructor): use g_signal_connect_object()
|
||
instead of g_signal_connect(). Fixes bug #140315.
|
||
|
||
2004-04-18 Pedro Gimeno <pggimeno@wanadoo.es>
|
||
|
||
* plug-ins/common/gauss_rle.c (gauss_rle): Oops, fixed my fix.
|
||
|
||
2004-04-18 Pedro Gimeno <pggimeno@wanadoo.es>
|
||
|
||
* plug-ins/common/gauss_iir.c: Change tabs to spaces all over the
|
||
file, in preparation for other changes. Minor cleanup.
|
||
|
||
* plug-ins/common/gauss_rle.c (gauss_rle): Plug a leak with the
|
||
returned value from make_curve().
|
||
|
||
* plug-ins/common/tga.c (load_image): Fix a condition which was
|
||
preventing GRAYA images from loading.
|
||
|
||
2004-04-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpenummenu.[ch]: removed GimpEnumMenu.
|
||
|
||
* app/widgets/gimpenumwidgets.[ch]: moved widget constructors that
|
||
don't use GimpEnumMenu from gimpenummenu.[ch] to these new files.
|
||
|
||
* app/widgets/gimpenumcombobox.[ch]: added a GtkComboBox widget
|
||
using GimpEnumStore; replaces GimpEnumMenu.
|
||
|
||
* app/widgets/gimpenumstore.[ch]: added new function
|
||
gimp_enum_store_lookup_by_value().
|
||
|
||
* app/widgets/gimppropwidgets.[ch]: replaced
|
||
gimp_prop_enum_option_menu_new() with gimp_prop_enum_combo_box_new().
|
||
|
||
* app/gui/brush-select.[ch]
|
||
* app/gui/convert-dialog.c
|
||
* app/gui/layers-commands.c
|
||
* app/gui/preferences-dialog.c
|
||
* app/gui/resize-dialog.c
|
||
* app/tools/gimpblendoptions.c
|
||
* app/tools/gimpcolorbalancetool.c
|
||
* app/tools/gimpcroptool.c
|
||
* app/tools/gimpcurvestool.c
|
||
* app/tools/gimplevelstool.c
|
||
* app/tools/gimpmagnifytool.c
|
||
* app/tools/gimppaintoptions-gui.c
|
||
* app/tools/gimpselectionoptions.c
|
||
* app/tools/gimptransformoptions.c
|
||
* app/widgets/gimpcolorframe.c
|
||
* app/widgets/gimpeditor.c
|
||
* app/widgets/gimpgrideditor.c
|
||
* app/widgets/gimphistogrameditor.c
|
||
* app/widgets/gimpstrokeeditor.c
|
||
* app/widgets/gimptemplateeditor.c
|
||
* app/widgets/gimptexteditor.c: ported to GimpEnumComboBox.
|
||
|
||
2004-04-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpenumstore.[ch]: added (yet unused) GimpEnumStore,
|
||
a GtkListStore for enum values.
|
||
|
||
2004-04-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/print/gimp_main_window.c: replaced wrong use of
|
||
gimp_option_menu with gimp_int_option_menu.
|
||
|
||
2004-04-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/script-fu-scripts.c: use a GtkComboBox for
|
||
SF-OPTION.
|
||
|
||
2004-04-18 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/winicon/icodialog.c
|
||
* plug-ins/winicon/icosave.c: ported GtkOptionMenu to GtkComboBox.
|
||
|
||
2004-04-17 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/widgets/gimpwidgets-constructors.[ch]:
|
||
s/GtkSignalFunc/GCallback/
|
||
|
||
2004-04-17 Henrik Brix Andersen <brix@gimp.org>
|
||
|
||
* app/tools/gimphuesaturationtool.c
|
||
(gimp_hue_saturation_tool_dialog): resolved conflicting
|
||
mnemonic. Fixes bug #139868.
|
||
|
||
2004-04-17 Henrik Brix Andersen <brix@gimp.org>
|
||
|
||
* plug-ins/common/jpeg.c (save_dialog): live preview doesn't
|
||
modify the undo history of the image anymore, label changed
|
||
accordingly. Fixes bug #140296.
|
||
|
||
2004-04-16 Pedro Gimeno <pggimeno@wanadoo.es>
|
||
|
||
* plug-ins/common/tile.c (tile): changed a call to
|
||
gimp_image_undo_enable to _undo_disable which was obviously the
|
||
intention of the author. Added a call to gimp_drawable_update to
|
||
get the previews refreshed.
|
||
|
||
2004-04-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimpcolorpickertool.c
|
||
* app/tools/gimpmeasuretool.c: don't use gtk_window_present() to
|
||
raise the tool dialog since it also moves the focus away from the
|
||
image window. Fixes the problem described in bug #139349.
|
||
|
||
2004-04-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimpcroptool.c: some code cleanup that I forgot to do
|
||
when applying the patch.
|
||
|
||
2004-04-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/helpbrowser/dialog.c (browser_dialog_load): present the
|
||
help browser window.
|
||
|
||
2004-04-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/helpbrowser/dialog.c: use a GtkComboBox instead of
|
||
GtkCombo and keep the history in a GtkListStore.
|
||
|
||
2004-04-16 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpmarshal.list: new marshaller VOID:STRING
|
||
|
||
* app/widgets/Makefile.am
|
||
* app/widgets/widgets-types.h
|
||
* app/widgets/gimpactiongroup.[ch]
|
||
* app/widgets/gimpenumaction.[ch]
|
||
* app/widgets/gimpstringaction.[ch]: added some completely unused
|
||
GtkAction infrastructure.
|
||
|
||
2004-04-15 Manish Singh <yosh@gimp.org>
|
||
|
||
* tools/Makefile.am
|
||
* app/Makefile.am
|
||
* configure.in: app, tools, and user dir bumped to version 2.1 names.
|
||
|
||
* app/text/gimpfontlist.c: since we now depend on pango 1.4, we can
|
||
use pango_fc_font_description_from_pattern() instead of our
|
||
cut-n-paste function, gimp_font_list_font_desc_from_pattern().
|
||
|
||
2004-04-15 Tor Lillqvist <tml@iki.fi>
|
||
|
||
* app/plug-in/plug-in-message.c (plug_in_handle_proc_install)
|
||
* app/plug-in/plug-in-proc.h (struct _PlugInProcDef)
|
||
* app/plug-in/plug-in-rc.c (plug_in_rc_write)
|
||
* app/plug-in/plug-ins.c (plug_ins_init): Make PDB procedures
|
||
(including their menu entries) installed during a plug-ins init()
|
||
phase show up. Add a flag to PlugInProcDef that tells whether the
|
||
proc was installed during the init() phase. Such procs aren't
|
||
saved to the pluginrc. Move the code that initializes plug-ins
|
||
that need initialization earlier, before the procs are added to
|
||
the PDB and menus are built. Fixes bug #139969.
|
||
|
||
2004-04-16 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/Makefile.am
|
||
* plug-ins/common/plugin-defs.pl
|
||
* plug-ins/common/AlienMap.c: removed the AlienMap plug-in since
|
||
AlienMap2 duplicates its functionality.
|
||
|
||
* plug-ins/common/AlienMap2.c: applied patch from William Skaggs
|
||
with a couple of user interface improvements (bug #140079).
|
||
|
||
2004-04-15 Tor Lillqvist <tml@iki.fi>
|
||
|
||
* libgimpthumb/Makefile.am: For Win32, install gimpthumb.def, like
|
||
the .def files of the other libgimp* libs.
|
||
|
||
* app/Makefile.am (INCLUDES): Add PANGOFT2_CFLAGS.
|
||
|
||
* gimp-zip.in: Put also libgimpthumb in the developer package.
|
||
|
||
2004-04-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/winicon/icodialog.c: fixed gtk+ includes, added a
|
||
warning that deprecated widgets are being used.
|
||
|
||
2004-04-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* configure.in
|
||
* plug-ins/Makefile.am
|
||
* plug-ins/winicon/Makefile.am
|
||
* plug-ins/winicon/icodialog.[ch]
|
||
* plug-ins/winicon/icoload.[ch]
|
||
* plug-ins/winicon/icosave.[ch]
|
||
* plug-ins/winicon/main.[ch]: added plug-in to load and save
|
||
Windows icon files. Plug-in written by Christian Kreibich, port to
|
||
GIMP-2.0 API by Gregor Riepl, massive code cleanup by me. Fixes
|
||
bug #139160.
|
||
|
||
2004-04-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpdnd.c (gimp_dnd_data_source_add)
|
||
(gimp_dnd_data_source_remove): use the new dynamic GtkTargetList
|
||
based API for changing the widget's drag source types.
|
||
|
||
* app/widgets/gimpdocumentview.c (gimp_document_view_new): simply
|
||
call gimp_dnd_file_source_add() instead of duplicating the whole
|
||
GtkTargetEntry array insanity just for adding one source type.
|
||
|
||
2004-04-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/FractalExplorer/Dialogs.c
|
||
* plug-ins/flame/flame.c
|
||
* plug-ins/gfig/gfig.c: first plug-ins ported to GtkFileChooser.
|
||
|
||
2004-04-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-callbacks.c
|
||
* app/display/gimpdisplayshell.c
|
||
* app/widgets/gimpcontainertreeview.c: removed runtime version
|
||
checks and workarounds for bugs which are fixed in GTK+ 2.4.
|
||
|
||
* app/widgets/gimpfiledialog.c
|
||
(gimp_file_dialog_selection_changed): added runtime check for GTK+
|
||
2.4.1 and work around GtkFileChooser's missing "update_preview"
|
||
functionality for multiple selections if the dependency is not
|
||
met.
|
||
|
||
* app/widgets/gimpwidgets-utils.c (gimp_menu_position)
|
||
(gimp_menu_button_position): call gtk_menu_set_monitor() until
|
||
bug #139187 is fixed.
|
||
|
||
2004-04-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/widgets/gimpfiledialog.[ch]: derive it from GtkFileChooser
|
||
instead of GtkFileSelection.
|
||
|
||
* app/gui/file-dialog-utils.c
|
||
* app/gui/file-open-dialog.c
|
||
* app/gui/file-save-dialog.c
|
||
* app/widgets/gimpthumbbox.c: changed accordingly.
|
||
|
||
* app/gui/gradients-commands.c
|
||
* app/gui/vectors-commands.c
|
||
* app/tools/gimpimagemaptool.c
|
||
* app/widgets/gimperrorconsole.c
|
||
* app/widgets/gimptexteditor.c
|
||
* libgimpwidgets/gimpfileentry.c: use file choosers instead of
|
||
file selectors.
|
||
|
||
2004-04-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* configure.in: depend on glib 2.4.0, gtk+ 2.4.0, pangoft2 1.4.0
|
||
|
||
* app/sanity.c: changed accordingly.
|
||
|
||
2004-04-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimpcropoptions.[ch]
|
||
* app/tools/gimpcroptool.[ch]: applied a patch from Jordi Gay that
|
||
allows to keep the aspect ratio fixed.
|
||
|
||
2004-04-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimplayermask.c (gimp_layer_mask_class_init): set
|
||
translate_desc to "Move Layer Mask".
|
||
|
||
* app/tools/gimpeditselectiontool.c: take the undo desc
|
||
from the moved item's class instead of duplicating all
|
||
strings here.
|
||
|
||
2004-04-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimppalette-import.[ch]
|
||
* app/gui/palette-import-dialog.c: added palette import from RIFF
|
||
palette files based on a patch from ÃRDI Gergõ (bug #129788).
|
||
|
||
2004-04-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/xcf/xcf.c (xcf_save_invoker) (xcf_load_invoker): forgot
|
||
to add context parameters to this non-generated PDB invokers.
|
||
Fixes XCF loading/saving.
|
||
|
||
2004-04-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpitem.[ch]: added "const gchar *stroke_desc" to
|
||
the GimpItemClass struct and always push an undo group
|
||
around GimpItem::stroke().
|
||
|
||
* app/core/gimpchannel.c
|
||
* app/core/gimpselection.c
|
||
* app/vectors/gimpvectors.c: set the stroke_desc accordingly
|
||
and don't push undo groups.
|
||
|
||
* app/text/gimptextlayer.c (gimp_text_layer_class_init): set
|
||
all of GimpItemClass' undo_descs.
|
||
|
||
* app/text/gimptextlayer-transform.c: don't push undo groups here.
|
||
|
||
2004-04-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpcolor/gimpcolorspace.c (gimp_rgb_to_hsv): applied patch
|
||
from Marco Munari that removes a redundant "if" (bug #133540).
|
||
|
||
2004-04-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/ifscompose/ifscompose.c: applied patch from Yeti that
|
||
adds spinbuttons instead of simple text entries (bug #138132).
|
||
|
||
2004-04-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/Makefile.am
|
||
* plug-ins/common/plugin-defs.pl
|
||
* plug-ins/common/gicon.c: removed the GIcon plug-in (addresses
|
||
one aspect of bug #139160).
|
||
|
||
2004-04-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
Context cleanup continued:
|
||
|
||
* app/core/gimpitem.[ch]: added context parameter to
|
||
GimpItem::stroke().
|
||
|
||
* app/core/gimpchannel.c (gimp_channel_stroke)
|
||
* app/vectors/gimpvectors.c (gimp_vectors_stroke): use it to get
|
||
default values from instead of gimp_get_user_context().
|
||
|
||
* app/core/gimpselection.c
|
||
* app/gui/stroke-dialog.c
|
||
* tools/pdbgen/pdb/edit.pdb
|
||
* tools/pdbgen/pdb/paths.pdb: changed accordingly.
|
||
|
||
* app/pdb/edit_cmds.c
|
||
* app/pdb/paths_cmds.c: regenerated.
|
||
|
||
* app/plug-in/plug-in.[ch]: added GimpContext member to the PlugIn
|
||
struct. Added context parameter to plug_in_new(),
|
||
plug_in_call_query() and plug_in_call_init().
|
||
|
||
* app/plug-in/plug-in-run.[ch]: added context parameters to
|
||
plug_in_run() and plug_in_repeat().
|
||
|
||
* app/gui/plug-in-commands.c
|
||
* app/gui/vectors-commands.c
|
||
* app/pdb/procedural_db.c
|
||
* app/widgets/gimphelp.c: pass a context to plug_in_run() and
|
||
plug_in_repeat().
|
||
|
||
* app/plug-in/plug-in-message.c (plug_in_handle_proc_run): call
|
||
procedures with the plug-in's context.
|
||
|
||
* app/plug-in/plug-ins.c: use a temporary context for running the
|
||
plug-ins' query() and init() functions. Use the same context for
|
||
running automatic extensions. This temporarily separates the main
|
||
Script-Fu extension from the user context (i.e. scripts have no
|
||
way of setting/getting the global FG, BG, brush etc.).
|
||
|
||
2004-04-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* NEWS
|
||
* README: mention that this is the development branch.
|
||
|
||
2004-04-15 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/paint-funcs/paint-funcs.[ch]:
|
||
* app/paint-funcs/paint-funcs-generic.h: header cleanup, added
|
||
some const qualifiers, converted tabs to spaces. Fixes bug #140115
|
||
for the HEAD branch.
|
||
|
||
2004-04-15 Michael Natterer <mitch@gimp.org>
|
||
|
||
Get rid of the "current_context" which was in fact just a bunch of
|
||
global variables. Instead, pass the needed context all the way
|
||
from the GUI and the PDB to the core. This is a prerequisite for
|
||
macro recording and generally helps separating the various
|
||
subsystems from each other. Work in progress...
|
||
|
||
* app/core/gimp.[ch]: removed member "current_context" and
|
||
gimp_[get|set]_current_context().
|
||
|
||
* app/core/gimp-edit.[ch]
|
||
* app/core/gimpdrawable-blend.[ch]
|
||
* app/core/gimpdrawable-bucket-fill.[ch]
|
||
* app/core/gimpdrawable-offset.[ch]
|
||
* app/core/gimpdrawable-transform.[ch]
|
||
* app/core/gimpimage-crop.[ch]
|
||
* app/core/gimpimage-flip.[ch]
|
||
* app/core/gimpimage-merge.[ch]
|
||
* app/core/gimpimage-resize.[ch]
|
||
* app/core/gimpimage-rotate.[ch]
|
||
* app/core/gimpimage.[ch]
|
||
* app/core/gimpimagefile.[ch]
|
||
* app/core/gimpitem-linked.[ch]
|
||
* app/core/gimpitem.[ch]
|
||
* app/core/gimplayer.[ch]
|
||
* app/core/gimpselection.[ch]
|
||
* app/core/gimptemplate.[ch]
|
||
* app/file/file-open.[ch]
|
||
* app/file/file-save.[ch]
|
||
* app/pdb/procedural_db.[ch]
|
||
* app/text/gimptext-compat.[ch]
|
||
* app/text/gimptextlayer-transform.[ch]
|
||
* app/gui/brush-select.[ch]
|
||
* app/gui/font-select.[ch]
|
||
* app/gui/gradient-select.[ch]
|
||
* app/gui/palette-select.[ch]
|
||
* app/gui/pattern-select.[ch]: added tons of "GimpContext *context"
|
||
parameters and use the passed context instead of
|
||
gimp_get_current_context().
|
||
|
||
* app/app_procs.c
|
||
* app/batch.c
|
||
* app/core/gimpchannel.c
|
||
* app/core/gimpdrawable.c
|
||
* app/paint/gimperaser.c
|
||
* app/paint/gimppaintbrush.c
|
||
* app/plug-in/plug-in-message.c
|
||
* app/plug-in/plug-ins.c
|
||
* app/text/gimptextlayer.c
|
||
* app/tools/gimpblendtool.c
|
||
* app/tools/gimpbucketfilltool.c
|
||
* app/tools/gimpcroptool.c
|
||
* app/tools/gimpeditselectiontool.c
|
||
* app/tools/gimpfliptool.c
|
||
* app/tools/gimpinktool.c
|
||
* app/tools/gimptransformtool.c
|
||
* app/vectors/gimpvectors.c
|
||
* app/gui/convert-dialog.c
|
||
* app/gui/drawable-commands.c
|
||
* app/gui/edit-commands.c
|
||
* app/gui/file-commands.c
|
||
* app/gui/file-new-dialog.c
|
||
* app/gui/file-open-dialog.c
|
||
* app/gui/file-save-dialog.c
|
||
* app/gui/image-commands.c
|
||
* app/gui/layers-commands.c
|
||
* app/gui/offset-dialog.c
|
||
* app/gui/select-commands.c
|
||
* app/gui/vectors-commands.c
|
||
* app/widgets/gimpdnd.c
|
||
* app/widgets/gimpdocumentview.c
|
||
* app/widgets/gimphelp.c
|
||
* app/widgets/gimpthumbbox.c: pass gimp_get_user_context() or
|
||
GIMP_CONTEXT(tool_options) or whatever is the right context
|
||
to the changed core functions.
|
||
|
||
* tools/pdbgen/app.pl: pass "GimpContext *context" to all
|
||
generated PDB invokers.
|
||
|
||
* tools/pdbgen/pdb/brush_select.pdb
|
||
* tools/pdbgen/pdb/brushes.pdb
|
||
* tools/pdbgen/pdb/drawable.pdb
|
||
* tools/pdbgen/pdb/edit.pdb
|
||
* tools/pdbgen/pdb/font_select.pdb
|
||
* tools/pdbgen/pdb/gradient_select.pdb
|
||
* tools/pdbgen/pdb/gradients.pdb
|
||
* tools/pdbgen/pdb/image.pdb
|
||
* tools/pdbgen/pdb/layer.pdb
|
||
* tools/pdbgen/pdb/paint_tools.pdb
|
||
* tools/pdbgen/pdb/palette.pdb
|
||
* tools/pdbgen/pdb/palette_select.pdb
|
||
* tools/pdbgen/pdb/palettes.pdb
|
||
* tools/pdbgen/pdb/paths.pdb
|
||
* tools/pdbgen/pdb/pattern_select.pdb
|
||
* tools/pdbgen/pdb/patterns.pdb
|
||
* tools/pdbgen/pdb/selection.pdb
|
||
* tools/pdbgen/pdb/text_tool.pdb
|
||
* tools/pdbgen/pdb/transform_tools.pdb: pass the new context
|
||
parameter to the changed core functions.
|
||
|
||
* app/pdb/*_cmds.c: regenerated.
|
||
|
||
2004-04-14 Raphaël Quinet <quinet@gamers.org>
|
||
|
||
* plug-ins/script-fu/scripts/copy-visible.scm: New version of the
|
||
script that works on a temporary copy of the image instead of
|
||
copying the visible layers. Fixes bug #139989.
|
||
|
||
2004-04-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/common/film.c: fixed typo (bug #140039).
|
||
|
||
2004-04-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* configure.in: bumped version to 2.1.0, interface age 0, binary
|
||
age 0. Changed library versioning to include gimp_minor_version
|
||
similar to how gtk+ does it.
|
||
|
||
2004-04-14 Sven Neumann <sven@gimp.org>
|
||
|
||
* Made 2.0.1 release.
|
||
|
||
2004-04-13 Raphaël Quinet <quinet@gamers.org>
|
||
|
||
* plug-ins/common/mng.c (query, run): Workaround for bug #139947:
|
||
do not register the plug-in for INDEXED* modes and do not declare
|
||
that it can handle INDEXED images in gimp_export_image(). This
|
||
forces a conversion to RGB instead of generating broken indexed
|
||
images. The generation of correct indexed MNG files is likely to
|
||
require a newer release of libmng.
|
||
(mng_data): Set default compression level to 9 instead of 6.
|
||
|
||
2004-04-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/imagemap/imap_cern_parse.c
|
||
* plug-ins/imagemap/imap_csim_parse.c
|
||
* plug-ins/imagemap/imap_ncsa_parse.c: regenerated using GNU Bison
|
||
version 1.875a. Fixes bug #139894.
|
||
|
||
2004-04-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/gimp-remote.c: reverted last change and go back to the
|
||
solution using fork(). Hopefully fixes bug #139158 this time.
|
||
|
||
2004-04-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimp-utils.[ch] (gimp_get_default_language): added a
|
||
category parameter to make this function more flexible.
|
||
|
||
* app/text/gimptext.c: changed accordingly.
|
||
|
||
* app/widgets/gimphelp.c (gimp_help): localize the help pages
|
||
according to the value of LC_MESSAGES. Fixes bug #139917.
|
||
|
||
2004-04-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
Moved the calls to floating_sel_relax()/rigor() from various
|
||
places to two single spots in the core where they are actually
|
||
needed. Fixes bug #138356 (which was caused by the projection
|
||
being triggered in the middle of changing the floating selection's
|
||
size or the size of the drawable it is attached to). This commit
|
||
effectively removes floating selection fiddling from the core's
|
||
public API.
|
||
|
||
* app/core/gimpdrawable.[ch] (gimp_drawable_has_floating_sel): new
|
||
function which returns TRUE if there is a floating selection
|
||
attached to the drawable.
|
||
|
||
* app/core/gimpdrawable.c (gimp_drawable_translate)
|
||
(gimp_drawable_set_tiles_full): if the drawable *has* a floating
|
||
selection, relax/rigor it before/after modifying the drawable.
|
||
|
||
* app/core/gimplayer.c (gimp_layer_translate)
|
||
(gimp_layer_set_tiles): if the layer *is* the floating selection,
|
||
relax/rigor it before/after modifying it.
|
||
|
||
* app/core/gimpdrawable-transform.c
|
||
* app/core/gimpimage-convert.c
|
||
* app/core/gimpimage-crop.c
|
||
* app/core/gimpimage-flip.c
|
||
* app/core/gimpimage-resize.c
|
||
* app/core/gimpimage-rotate.c
|
||
* app/core/gimpimage-scale.c
|
||
* app/gui/layers-commands.c
|
||
* app/tools/gimpeditselectiontool.c
|
||
* tools/pdbgen/pdb/layer.pdb: removed calls to
|
||
floating_sel_rigor()/relax() all over the place. Also removed
|
||
lots of undo groups which are obsolete now.
|
||
|
||
* app/pdb/layer_cmds.c: regenerated.
|
||
|
||
2004-04-13 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/imagemap/imap_file.c (do_file_error_dialog): convert
|
||
the filename to UTF-8 before displaying it.
|
||
|
||
2004-04-13 Michael Natterer <mitch@gimp.org>
|
||
|
||
GimpItem undo group cleanup in preparation of fixing bug #138356:
|
||
|
||
* app/core/core-enums.[ch]: renamed LAYER_SCALE and LAYER_RESIZE
|
||
undo groups to ITEM_SCALE and ITEM_RESIZE.
|
||
|
||
* app/core/gimpitem.[ch]: always push undo groups around
|
||
GimpItem::translate(), scale(), resize(), flip(), rotate() and
|
||
transform(). Added the resp. undo_desc strings to GimpItemClass.
|
||
|
||
* app/core/gimpchannel.[ch]
|
||
* app/core/gimpdrawable.[ch]
|
||
* app/core/gimplayer.c: removed all undo groups from
|
||
implementations of the above methods. Removed the undo_desc
|
||
strings which were moved to GimpItemClass.
|
||
|
||
* app/core/gimpimage-crop.c
|
||
* app/core/gimpselection.c
|
||
* app/gui/layers-commands.c
|
||
* app/vectors/gimpvectors.c
|
||
* tools/pdbgen/pdb/layer.pdb: changed accordingly.
|
||
|
||
* app/pdb/layer_cmds.c: regenerated.
|
||
|
||
2004-04-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* configure.in: cleaned up the check for Xmu. Include <gdk/gdkx.h>
|
||
when testing for Xmu.h. Fixes bug #139803.
|
||
|
||
2004-04-12 Sven Neumann <sven@gimp.org>
|
||
|
||
* libgimpmath/Makefile.am: remove test-md5 on make clean.
|
||
|
||
2004-04-11 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/pygimp/plug-ins/py-slice.py: When using a separate dir for
|
||
images, actually prepend the dir to the img srcs in the html. Allow
|
||
only horizontal or vertical guides in an image, do not require both.
|
||
A bit smarter path handling. Addresses most of bug #138714.
|
||
|
||
2004-04-11 Hans Breuer <hans@breuer.org>
|
||
|
||
* app/makefile.msc : build sanity.obj
|
||
app/text/makefile.msc : gimptextundo.obj
|
||
app/widgets/makefile.msc : gimppatternfactoryview.obj
|
||
|
||
* plug-ins/common/winclipboard.c : don't call
|
||
gimp_image_undo_enable() when it's not switched off.
|
||
Otherwise the undo history would be destroyed with
|
||
Gimp-Core-CRITICAL **: file gimpimage.c: line 1579: assertion
|
||
`gimage->undo_freeze_count > 0' failed
|
||
|
||
2004-04-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/tools/gimptexttool.c (gimp_text_tool_apply): push an undo
|
||
group only when it's needed. This resurrects text undo compression
|
||
that broke when bug #137767 got fixed.
|
||
|
||
2004-04-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* docs/gimp-remote.1.in: updated example URL.
|
||
|
||
2004-04-10 Pedro Gimeno <pggimeno@wanadoo.es>
|
||
|
||
* app/core/gimpdrawable-transform.c
|
||
(gimp_drawable_transform_tiles_affine): Applied patch from William
|
||
Skaggs that addresses bug #120490.
|
||
|
||
* app/sanity.c (sanity_check): Modified the message that reports
|
||
an old version of Fontconfig in an attempt to make it more
|
||
informative.
|
||
|
||
2004-04-10 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/gimp-remote.c (start_new_gimp): reverted the last change
|
||
and did a different fix that involves closing the X display before
|
||
starting gimp (bug #139158).
|
||
|
||
2004-04-09 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/common/jpeg.c: Uglier workaround for bug #138357, since
|
||
the previous one did break error handling. Fixes bug #139571.
|
||
|
||
2004-04-09 Henrik Brix Andersen <brix@gimp.org>
|
||
|
||
* README.i18n: s/14/20/ plus whitespace clean-up.
|
||
|
||
2004-04-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/siod-wrapper.c: applied a patch from Kevin
|
||
Cozens that makes the Script-Fu PDB marshaller handle NULL
|
||
strings. Some minor code cleanup. Fixes bug #139386.
|
||
|
||
2004-04-08 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/gimp-remote.c (start_new_gimp): applied a patch from
|
||
Michael Matz that calls fork() before starting gimp. This is to
|
||
avoid X server authentification problems (bug #139158).
|
||
|
||
2004-04-07 Henrik Brix Andersen <brix@gimp.org>
|
||
|
||
* configure.in (ALL_LINGUAS): revert addition of "is" until all
|
||
.po files are there.
|
||
|
||
2004-04-07 Samúel Jón Gunnarsson <sammi@techattack.nu>
|
||
|
||
* configure.in: Added "is" to ALL_LINGUAS
|
||
|
||
2004-04-06 Iñaki Larrañaga <dooteo@euskalgnu.org>
|
||
|
||
* configure.in: Added "eu" (Basque) to ALL_LINGUAS.
|
||
|
||
2004-04-05 Pedro Gimeno <pggimeno@wanadoo.es>
|
||
|
||
* plug-ins/script-fu/scripts/copy-visible.scm: Use
|
||
gimp-image-get-active-layer/channel instead of the passed
|
||
drawable for later restoring the initially active layer/channel.
|
||
Addresses bug #138662.
|
||
|
||
* plug-ins/script-fu/scripts/drop-shadow.scm: Add a call to
|
||
gimp-image-set-active-layer in order for it to fail early instead
|
||
of failing with the undo group open in case the drawable is not
|
||
suitable for applying the effect.
|
||
|
||
2004-04-05 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpimage.c (gimp_image_real_mode_changed): update the
|
||
whole image.
|
||
|
||
* app/display/gimpdisplay-handlers.c: removed obsolete
|
||
"mode_changed" and "colormap_changed" handlers because GimpImage's
|
||
default handlers already update the whole image.
|
||
|
||
2004-04-05 Pedro Gimeno <pggimeno@wanadoo.es>
|
||
|
||
Sanitize rectangle and ellipse selection handling (bug #138237
|
||
and bug #138103):
|
||
|
||
* app/tools/gimprectselecttool.h
|
||
* app/tools/gimprectselecttool.c (GimpRectSelectTool): new
|
||
member "moved" indicating whether the cursor was moved after
|
||
the click.
|
||
(gimp_rect_select_tool_coords_to_integer): New function for
|
||
consistent conversion of the rectangle FP coords to pixels.
|
||
(gimp_rect_select_tool_button_press,
|
||
gimp_rect_select_tool_button_release,
|
||
gimp_rect_select_tool_motion, gimp_rect_select_tool_draw): use
|
||
it instead of fiddling with the FP coordinates. Update "moved"
|
||
and use it to detect whether the selection needs to be cleared.
|
||
|
||
* app/tools/gimpellipseselecttool.c
|
||
(gimp_ellipse_select_tool_draw): use the new coords_to_integer
|
||
function.
|
||
|
||
2004-04-05 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/Lighting/lighting_ui.c: applied the second patch
|
||
attached to bug #138788 by William Skaggs. Removes some user
|
||
interface elements that have no corresponding implementation and
|
||
fixes preview updates.
|
||
|
||
2004-04-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* Makefile.am
|
||
* NEWS.pre-2-0: moved old NEWS to this new file.
|
||
|
||
* NEWS: list bugs fixed since 2.0.0.
|
||
|
||
2004-04-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* Makefile.am
|
||
* docs/Makefile.am: don't install gimptool symlinks to
|
||
gimptool-2.0 and its manpage. gimp.m4 as installed with gimp-1.2
|
||
looks for gimptool (bug #139024).
|
||
|
||
2004-04-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/display/gimpdisplayshell-callbacks.c
|
||
* app/display/gimpdisplayshell-draw.[ch] pass the bounding box of
|
||
the exposed area to gimp_display_shell_draw_grid() and draw only
|
||
the relevant part of the grid. Fixes bug #138081.
|
||
|
||
2004-04-04 Sven Neumann <sven@gimp.org>
|
||
|
||
Cache the GC for drawing the grid as suggested in bug #138081:
|
||
|
||
* app/display/gimpdisplayshell.[ch]: added a grid_gc member to
|
||
GimpDisplayShell.
|
||
|
||
* app/display/gimpdisplayshell-handlers.c
|
||
(gimp_display_shell_grid_notify_handler)
|
||
(gimp_display_shell_disconnect): invalidate the grid GC.
|
||
|
||
* app/display/gimpdisplayshell-draw.c (gimp_display_shell_draw_grid):
|
||
use the cached grid_gc. Also applied the fix that Pedro Gimeno did
|
||
for bug #138606.
|
||
|
||
2004-04-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpundo.c (gimp_undo_type_to_name): added a missing
|
||
call to gettext(). Fixes bug #139000.
|
||
|
||
2004-04-03 Manish Singh <yosh@gimp.org>
|
||
|
||
* gimptool-2.0.in: Create any directories in the install path that do
|
||
not already exist. Fixes bug #138980.
|
||
|
||
* docs/gimptool.1.in: s/dont/don't/g
|
||
|
||
2004-04-04 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/core/gimpimagemap.c (gimp_image_map_apply): do nothing if the
|
||
selection is empty. Fixes bug #138973.
|
||
|
||
2004-04-03 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/text/gimptextlayer.c (gimp_text_layer_new): create the
|
||
initial text layer with a size of 1 x 1 since tile_manager_new()
|
||
does not any longer accept 0 x 0.
|
||
|
||
* app/core/gimpdrawable.c (gimp_drawable_configure): check that
|
||
width and height are > 0.
|
||
|
||
2004-04-03 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/Lighting/lighting_main.c
|
||
* plug-ins/Lighting/lighting_shade.c: applied the first of two
|
||
patches attached to bug #138788 by William Skaggs.
|
||
|
||
2004-04-02 Simon Budig <simon@gimp.org>
|
||
|
||
* plug-ins/common/whirlpinch.c: set a proper pixelfetcher
|
||
edge mode for bigger radii. Avoids getting garbage at the
|
||
image borders.
|
||
|
||
2004-04-02 Dave Neary <bolsh@gimp.org>
|
||
|
||
* plug-ins/common/jpeg.c: Added .jpe to the list of extensions
|
||
that the jpeg plug-in recognises. Fixes bug #138776.
|
||
|
||
2004-04-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/gui/user-install-dialog.c: unset the bg_pixmap and tweak
|
||
style colors for all states. Sort of ugly but makes the dialog
|
||
work better with more obscure themes (bug #138379).
|
||
|
||
2004-04-01 Sven Neumann <sven@gimp.org>
|
||
|
||
* tools/kernelgen.c: updated a comment.
|
||
|
||
2004-04-01 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/core-enums.[ch] (enum GimpUndoType): added undo type
|
||
GIMP_UNDO_TEXT_LAYER_MODIFIED and undo group types
|
||
GIMP_UNDO_GROUP_DRAWABLE and GIMP_UNDO_GROUP_DRAWABLE_MOD.
|
||
|
||
* app/core/gimpimage-undo-push.[ch]: added new new function
|
||
gimp_image_undo_push_text_layer_modified() which makes
|
||
modifications of the text_layer's "modified" boolean undoable.
|
||
|
||
* app/core/gimpdrawable.[ch]: added new virtual function
|
||
GimpDrawable::push_undo() and moved the actual undo pushing into
|
||
the default implementation gimp_drawable_real_push_undo().
|
||
|
||
* app/text/gimptextlayer.c (gimp_text_layer_push_undo): new
|
||
function. Pushes the text_layer's modified state to the undo stack
|
||
after upchaining and sets modified to TRUE.
|
||
|
||
(gimp_text_layer_set_tiles): ditto.
|
||
|
||
(gimp_lext_layer_apply_region)
|
||
(gimp_text_layer_replace_region): removed because their default
|
||
implementations already call gimp_drawable_push_undo().
|
||
|
||
(gimp_text_layer_swap_pixels): removed because swap_pixels() is
|
||
used by undo only and doesn't need to care about the text_layer's
|
||
modified state.
|
||
|
||
(gimp_text_layer_render): don't set modified to FALSE here because
|
||
we can't push an undo step here.
|
||
|
||
(gimp_text_layer_set): push the modified state to the undo stack
|
||
and set it to FALSE here. Also push the layer's tiles if the
|
||
layer was modified.
|
||
|
||
* app/tools/gimptexttool.c (gimp_text_tool_apply): push "modified"
|
||
to the undo stack and set it to FALSE here, too.
|
||
|
||
Fixes bug #137767.
|
||
|
||
2004-03-31 Simon Budig <simon@gimp.org>
|
||
|
||
* app/tools/gimptransformtool.c: One really should use braces
|
||
when mixing additions and multiplication and the operator
|
||
precedence is not the desired one...
|
||
|
||
I feel stupid... :-)
|
||
|
||
2004-03-31 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimp-transform-utils.c
|
||
(gimp_transform_matrix_perspective): make sure 0.0/0.0 results
|
||
in 1.0, not NaN.
|
||
|
||
* app/core/gimpdrawable-transform.c
|
||
(gimp_drawable_transform_tiles_affine): instead of returning NULL
|
||
if the transformation shrinks the tiles completely away, return at
|
||
least the pixel (or the row or column of pixels) which best covers
|
||
the sub-pixel area of the transform result:
|
||
|
||
- Changed rounding of the transformed coordinates from RINT()
|
||
to floor()/ceil() so we don't cut off sub-pixel portions of the
|
||
transform result.
|
||
- Force the minimal size if the changed rounding didn't help.
|
||
|
||
Fixes bug #138117.
|
||
|
||
Also added paranoia code which falls back to clip_result if the
|
||
passed matrix produces NaN coordinates (copied the FINITE() macro
|
||
from image_cmds.c).
|
||
|
||
2004-03-30 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/grid-system.scm: define "map" here,
|
||
the script used to take the definition from alien-glow-arrow.scm
|
||
or beveled-pattern-arrow.scm. Also added an undo group around all
|
||
operations. Fixes bug #138524.
|
||
|
||
2004-03-30 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/Makefile.am
|
||
* app/sanity.[ch]: new files implementing sanity_check() for
|
||
run-time checking library versions. Added a check for FreeType but
|
||
disabled it until we figured if and how freetype causes some of
|
||
the DLL hell bugs.
|
||
|
||
* app/main.c (main): call it and abort if it fails.
|
||
|
||
* app/app_procs.[ch]: added app_gui_abort() so main.c doesn't
|
||
need to #include "gui/gui.h"
|
||
|
||
* app/gui/gui.[ch] (gui_libs_init): removed library sanity checking.
|
||
|
||
(gui_abort): new function which shows the abort message.
|
||
|
||
2004-03-30 Michael Natterer <mitch@gimp.org>
|
||
|
||
* configure.in (ALL_LINGUAS): revert addition of "pa" until
|
||
all .po files are there.
|
||
|
||
2004-03-20 Guntupalli Karunakar <karunakar@freedomink.org>
|
||
|
||
* configure.in: Added "pa" for Punjabi to ALL_LINGUAS.
|
||
|
||
2004-03-29 Manish Singh <yosh@gimp.org>
|
||
|
||
* plug-ins/common/jpeg.c (struct my_error_mgr): Move setjump_buffer
|
||
to the beginning of the structure, to make sure it is aligned on a
|
||
16-byte boundary for ia64, even with icc. Fixes #138357.
|
||
|
||
2004-03-29 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/config/gimpguiconfig.c: changed the default for "help-locales"
|
||
from NULL to an empty string. Fixes the generated gimprc man-page.
|
||
|
||
* app/config/gimprc-blurbs.h (HELP_LOCALES_BLURB): added missing
|
||
whitespace.
|
||
|
||
* app/widgets/gimphelp.c: use the user's locale if "help-locales"
|
||
is NULL or the empty string.
|
||
|
||
* docs/gimprc.5.in
|
||
* etc/gimprc: regenerated.
|
||
|
||
2004-03-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/core-enums.[ch] (enum GimpUndoType): added new group
|
||
GIMP_UNDO_GROUP_FS_REMOVE.
|
||
|
||
* app/core/gimplayer-floating-sel.c (floating_sel_remove): push an
|
||
undo group. Fixes undo corruption spotted by Pedro Gimeno.
|
||
|
||
2004-03-29 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/guillotine.c (guillotine): Don't just skip
|
||
guides at the image edges but any guide which is at a position we
|
||
already remembered. Should catch all instances of bug #138312 this
|
||
time.
|
||
|
||
2004-03-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/ifscompose/ifscompose.c: applied patch from David Necas
|
||
that updates the sensitivity of the Delete button and menu entry.
|
||
Fixes bug #138212.
|
||
|
||
2004-03-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/MapObject/mapobject_main.c: fixed non-interactive call.
|
||
|
||
* plug-ins/script-fu/scripts/spinning-globe.scm: pass -1 as
|
||
drawable ID for unused drawables. Fixes bug #138253.
|
||
|
||
2004-03-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* app/text/gimpfontlist.c (gimp_font_list_add_font): validate the
|
||
font name. This should work around the crashes that Windows users
|
||
were experiencing on startup (bug #132366). The real problem needs
|
||
to be fixed elsewhere though.
|
||
|
||
2004-03-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpimage-undo-push.c (undo_pop_layer): when re-adding
|
||
a layer with mask, don't forget to set layer->mask->removed to FALSE.
|
||
|
||
2004-03-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpitem.[ch]: added "gboolean removed" to the GimpItem
|
||
struct. Defaults to FALSE. Set it to TRUE in gimp_item_removed().
|
||
Added public function gimp_item_is_removed().
|
||
|
||
* app/core/gimpimage-undo-push.c (undo_pop_layer)
|
||
(undo_pop_layer_mask) (undo_pop_channel) (undo_pop_vectors):
|
||
set it to FALSE manually when re-adding something from the
|
||
undo stack.
|
||
|
||
* tools/pdbgen/app.pl
|
||
* tools/pdbgen/pdb.pl: don't allow any operation on items which
|
||
are removed from the image (and exist on the undo stack only).
|
||
Fixes bug #138311.
|
||
|
||
* app/pdb/channel_cmds.c
|
||
* app/pdb/color_cmds.c
|
||
* app/pdb/drawable_cmds.c
|
||
* app/pdb/edit_cmds.c
|
||
* app/pdb/floating_sel_cmds.c
|
||
* app/pdb/image_cmds.c
|
||
* app/pdb/layer_cmds.c
|
||
* app/pdb/paint_tools_cmds.c
|
||
* app/pdb/parasite_cmds.c
|
||
* app/pdb/selection_cmds.c
|
||
* app/pdb/selection_tools_cmds.c
|
||
* app/pdb/transform_tools_cmds.c: regenerated.
|
||
|
||
2004-03-28 Sven Neumann <sven@gimp.org>
|
||
|
||
* plug-ins/script-fu/scripts/slide.scm: applied a (modified) patch
|
||
from Nils Philippsen that fixes bug #138310.
|
||
|
||
2004-03-28 Michael Natterer <mitch@gimp.org>
|
||
|
||
* plug-ins/common/guillotine.c (guillotine): applied a (modified)
|
||
patch from Joao S. O. Bueno which removes any guides from the
|
||
cropped images. Fixes bug #138314.
|
||
|
||
Skip guides which are at the image's edges because the algorithm
|
||
already assumes that there are always guides at these positions.
|
||
Fixes bug #138312.
|
||
|
||
2004-03-27 Tor Lillqvist <tml@iki.fi>
|
||
|
||
* plug-ins/help/Makefile.am (AM_LDFLAGS): Use -mwindows on Windows
|
||
to avoid a console window popping up.
|
||
|
||
2004-03-26 Manish Singh <yosh@gimp.org>
|
||
|
||
* tools/pdbgen/app.pl: don't generate code with tabs.
|
||
|
||
* tools/pdbgen/pdb/procedural_db.pdb: convert tabs to spaces in
|
||
helper function declaration.
|
||
|
||
* app/pdb/procedural_db.c: convert tabs to spaces.
|
||
|
||
* app/pdb/*.c: regenerated, no code changes, only tabs->spaces.
|
||
|
||
2004-03-26 Manish Singh <yosh@gimp.org>
|
||
|
||
* tools/pdbgen/app.pl: kill whitespace in blank lines.
|
||
|
||
* app/pdb/*.c: regenerated, no code changes, only whitespace.
|
||
|
||
2004-03-26 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/core/gimpdrawable-transform.c
|
||
(gimp_drawable_transform_tiles_affine): return NULL tiles if the
|
||
matrix would transform the drawable into nothing. Fixes the
|
||
core-crashing part of bug #138117 and makes the script fail
|
||
with an execution error.
|
||
|
||
2004-03-25 Sven Neumann <sven@gimp.org>
|
||
|
||
* README: mention the gimp-perl pre-release and provide a link.
|
||
|
||
2004-03-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/base/tile-manager.c (tile_manager_new): g_return_if_fail()
|
||
on width, height or bpp <= 0. Doesn't fix anything but badly
|
||
warns (and helps debugging) on bug #138117.
|
||
|
||
2004-03-25 Michael Natterer <mitch@gimp.org>
|
||
|
||
* app/tools/gimpvectortool.c (gimp_vector_tool_button_release):
|
||
fixed condition which triggers the path tool's undo hack. Fixes
|
||
bug #138086. Also g_object_unref() the undo step.
|
||
|
||
Removed trailing whitespace.
|
||
|
||
2004-03-25 Manish Singh <yosh@gimp.org>
|
||
|
||
* libgimp/gimp.c
|
||
* app/plug-in/plug-in-shm.c: close the shm_open fd in the POSIX
|
||
shm case. We were leaking an fd here.
|
||
|
||
* app/tools/gimptexttool.c (gimp_text_tool_connect): remove
|
||
unnecessary G_OBJECT() cast in g_object_set() call.
|
||
|
||
2004-03-23 Michael Natterer <mitch@gimp.org>
|
||
|
||
* autogen.sh: be verbose about AUTOGEN_CONFIGURE_ARGS in the
|
||
message that is printed if no arguments were passed.
|
||
|
||
2004-03-23 Sven Neumann <sven@gimp.org>
|
||
Michael Natterer <mitch@gimp.org>
|
||
|
||
* Made 2.0.0 release.
|