gimp/app/widgets
Sven Neumann 55d14fd0f0 Finished some work that Brix started on the help system. It's now possibly
2004-03-09  Sven Neumann  <sven@gimp.org>

	Finished some work that Brix started on the help system. It's
	now possibly to use an external web-browser for context help
	(bug #136081):

	* configure.in
	* plug-ins/Makefile.am
	* plug-ins/help/Makefile.am
	* plug-ins/help/domain.[ch]
	* plug-ins/help/help.c: new plug-in that does the help domain
	management. Most of this used to live in the helpbrowser plug-in.

	* plug-ins/helpbrowser/Makefile.am
	* plug-ins/helpbrowser/domain.[ch]: removed these two files here.

	* plug-ins/helpbrowser/helpbrowser.c: changed accordingly.

	* app/widgets/gimphelp.c: use the new help plug-in.
2004-03-09 01:37:56 +00:00
..
.cvsignore app/widgets/Makefile.am use gimp_mkenums to create widgets-enums.c, added 2002-03-18 22:26:41 +00:00
gimpbrusheditor.c Disallow editing of data objects which have no save functionality. Also 2004-02-05 22:17:14 +00:00
gimpbrusheditor.h undeprecated and simplified a lot by using GimpPreview instead of handmade 2003-03-05 12:17:12 +00:00
gimpbrushfactoryview.c Reduced the range of the spacing scale widget for convenience. Extreme 2003-08-14 06:51:48 +00:00
gimpbrushfactoryview.h app/widgets/gimpbrushfactoryview.[ch] app/widgets/gimpbufferview.[ch] 2003-04-08 12:39:02 +00:00
gimpbufferview.c app/core/gimpchannel.c app/tools/gimptexttool.c app/vectors/gimpvectors.c 2004-02-04 16:52:35 +00:00
gimpbufferview.h app/widgets/gimpbrushfactoryview.[ch] app/widgets/gimpbufferview.[ch] 2003-04-08 12:39:02 +00:00
gimpcellrenderertoggle.c allow keyboard activation. 2003-03-28 11:20:24 +00:00
gimpcellrenderertoggle.h app/widgets/gimpcellrenderertoggle.[ch] added public functions to emit the 2003-03-19 15:17:13 +00:00
gimpcellrendererviewable.c some general cleanup. 2004-02-28 19:20:16 +00:00
gimpcellrendererviewable.h app/widgets/gimpcellrenderertoggle.[ch] added public functions to emit the 2003-03-19 15:17:13 +00:00
gimpchanneltreeview.c Treat changes to the selection like changes to any other drawable: 2003-10-06 12:17:11 +00:00
gimpchanneltreeview.h Added GtkTreeView versions of layers/channels/vectors: 2003-03-16 11:14:29 +00:00
gimpcolorbar.c put the color bars into an event box and draw the sliders on the event box 2004-02-21 12:25:09 +00:00
gimpcolorbar.h put the color bars into an event box and draw the sliders on the event box 2004-02-21 12:25:09 +00:00
gimpcolordialog.c Some code review: 2004-02-18 13:43:50 +00:00
gimpcolordialog.h removed color_notebook_new() and renamed color_notebook_viewable_new() to 2003-11-10 17:55:44 +00:00
gimpcolordisplayeditor.c made "enabled" an object property and removed the "enabled_changed" 2003-11-23 13:08:56 +00:00
gimpcolordisplayeditor.h libgimpwidgets/gimpwidgetsmarshal.list added signals ::added(), 2003-11-22 15:54:12 +00:00
gimpcoloreditor.c don't do lazy binding on GIMP modules. We can't recover from missing 2003-11-18 23:44:35 +00:00
gimpcoloreditor.h added virtual functions set_toggles_visible() and set_toggles_sensitive(). 2002-11-05 00:02:56 +00:00
gimpcolorframe.c app/widgets/Makefile.am app/widgets/widgets-types.h added new widget 2004-02-19 19:56:04 +00:00
gimpcolorframe.h app/widgets/Makefile.am app/widgets/widgets-types.h added new widget 2004-02-19 19:56:04 +00:00
gimpcolormapeditor.c GDK_TYPE_MODIFIER_TYPE are flags, not enum values, use the right 2004-03-03 14:44:34 +00:00
gimpcolormapeditor.h Cleaned up all places which pick colors to work consistently: the concept 2003-09-26 13:33:54 +00:00
gimpcolorpanel.c Some code review: 2004-02-18 13:43:50 +00:00
gimpcolorpanel.h named the menu separator "/fg-bg-separator", not just "/---". 2002-12-03 22:16:56 +00:00
gimpcomponenteditor.c multihead fix: added gimp_preview_renderer_unrealize() which destroys the 2003-11-13 15:04:13 +00:00
gimpcomponenteditor.h added a GimpItemFactory to the GimpEditor struct. Added 2003-03-21 11:47:37 +00:00
gimpcontainereditor.c To be multihead safe, each new window or menu needs to be associated with 2003-11-08 15:32:38 +00:00
gimpcontainereditor.h app/widgets/gimpbrushfactoryview.[ch] app/widgets/gimpbufferview.[ch] 2003-04-08 12:39:02 +00:00
gimpcontainergridview.c Some code review: 2004-02-18 13:43:50 +00:00
gimpcontainergridview.h added a "selected_item" pointer to the GimpContainerGridView struct so we 2003-04-15 14:13:14 +00:00
gimpcontainermenu.c added GIMP_VIEWABLE_MAX_BUTTON_SIZE GIMP_VIEWABLE_MAX_MENU_SIZE. 2003-10-09 12:26:46 +00:00
gimpcontainermenu.h added vitrual function GimpViewable::get_description() which returns the 2003-04-08 16:01:01 +00:00
gimpcontainermenuimpl.c Some code review: 2004-02-18 13:43:50 +00:00
gimpcontainermenuimpl.h removed tree_view->preview_border_width. 2003-04-04 21:16:58 +00:00
gimpcontainerpopup.c app/widgets/gimpitemfactory.c moved the gimp_menu_position() 2003-11-19 18:08:15 +00:00
gimpcontainerpopup.h app/widgets/gimpcontainerpopup.[ch] let the button remember the popup's 2003-11-18 13:13:57 +00:00
gimpcontainertreeview-dnd.c according to an older mail from Owen, GDK_ACTION_DEFAULT means nothing and 2003-10-17 11:28:28 +00:00
gimpcontainertreeview-dnd.h app/widgets/gimpcellrenderertoggle.[ch] added public functions to emit the 2003-03-19 15:17:13 +00:00
gimpcontainertreeview.c removed the last artefact of context signal handling from 1.2: 2004-01-29 16:34:41 +00:00
gimpcontainertreeview.h removed the last artefact of context signal handling from 1.2: 2004-01-29 16:34:41 +00:00
gimpcontainerview-utils.c derive it from GtkBin, not from GtkVBox. Removed "content_spacing" style 2003-04-11 16:51:49 +00:00
gimpcontainerview-utils.h added vitrual function GimpViewable::get_description() which returns the 2003-04-08 16:01:01 +00:00
gimpcontainerview.c removed the last artefact of context signal handling from 1.2: 2004-01-29 16:34:41 +00:00
gimpcontainerview.h removed the last artefact of context signal handling from 1.2: 2004-01-29 16:34:41 +00:00
gimpcursor.c added a GdkDisplay parameter and added the convenience function 2003-11-01 20:53:18 +00:00
gimpcursor.h added a GdkDisplay parameter and added the convenience function 2003-11-01 20:53:18 +00:00
gimpdasheditor.c removed static variables, don't use GIMP_CONFIG_INSTALL_PROP_FOO() for 2004-02-19 16:42:24 +00:00
gimpdasheditor.h removed static variables, don't use GIMP_CONFIG_INSTALL_PROP_FOO() for 2004-02-19 16:42:24 +00:00
gimpdataeditor.c Fixed GimpData's default "writable" and "deletable" behaviour: 2004-02-13 11:53:22 +00:00
gimpdataeditor.h app/widgets/widgets-types.h added new struct GimpSessionInfoAux which 2003-10-11 16:50:35 +00:00
gimpdatafactoryview.c Fixed GimpData's default "writable" and "deletable" behaviour: 2004-02-13 11:53:22 +00:00
gimpdatafactoryview.h use gtk_widget_get_screen() instead of gdk_screen_get_default(). 2003-11-08 18:16:25 +00:00
gimpdeviceinfo.c cleanup, removed unecessary G_OBJECT() casts. Should do the same for 2003-01-05 22:07:10 +00:00
gimpdeviceinfo.h override GObjectClass->constructor() and do the setup stuff there, not in 2002-05-28 16:41:56 +00:00
gimpdevices.c code review & cleanup. 2003-11-14 12:38:01 +00:00
gimpdevices.h gimp/app/widgets/gimphelp-ids.h 2003-10-26 14:01:33 +00:00
gimpdevicestatus.c support '|'-separated lists of dialog identifiers and raise any of them if 2003-11-18 12:28:15 +00:00
gimpdevicestatus.h app/gui/Makefile.am removed... 2003-07-07 13:37:19 +00:00
gimpdialogfactory.c some cleanup while hunting window positioning bugs. 2003-12-21 21:51:58 +00:00
gimpdialogfactory.h support '|'-separated lists of dialog identifiers and raise any of them if 2003-11-18 12:28:15 +00:00
gimpdnd.c changed "svg_data" from guchar* to gchar*, cleaned up debugging output. 2003-12-21 21:57:46 +00:00
gimpdnd.h changed "svg_data" from guchar* to gchar*, cleaned up debugging output. 2003-12-21 21:57:46 +00:00
gimpdock.c g_assert() that we got the essential construct properties. 2004-01-31 18:54:53 +00:00
gimpdock.h added GimpWindowTypeHint enum. 2003-11-20 20:36:55 +00:00
gimpdockable.c suppress button_press events that reach the dockable widget but don't 2003-12-11 19:34:37 +00:00
gimpdockable.h app/widgets/Makefile.am app/widgets/widgets-types.h new files implementing 2003-10-10 21:24:12 +00:00
gimpdockbook.c removed the "Select Tab" menu and all the evil hacks that were needed to 2003-10-18 22:12:32 +00:00
gimpdockbook.h app/widgets/gimpdockbook.[ch] hide the GimpDockbook tabs when it holds 2003-10-05 17:26:21 +00:00
gimpdocked.c added new virtual function GimpDocked::get_title() which returns a custom 2003-10-21 14:49:12 +00:00
gimpdocked.h added new virtual function GimpDocked::get_title() which returns a custom 2003-10-21 14:49:12 +00:00
gimpdocumentview.c removed the size parameter and do nothing but invalidating the preview. 2004-01-10 23:55:28 +00:00
gimpdocumentview.h app/gui/file-commands.[ch] app/gui/file-dialog-utils.[ch] 2003-11-09 22:05:37 +00:00
gimpdrawabletreeview.c To be multihead safe, each new window or menu needs to be associated with 2003-11-08 15:32:38 +00:00
gimpdrawabletreeview.h removed "visible" and all its API... 2003-09-11 19:52:29 +00:00
gimpeditor.c cannot gtk_widget_destroy() a floating widget, sink it instead. 2004-02-17 20:17:49 +00:00
gimpeditor.h new utility function which sets a button box' style according to a 2003-11-12 00:21:58 +00:00
gimpenummenu.c Add GTK_MISC cast for bin->child. 2004-02-21 23:43:57 +00:00
gimpenummenu.h put the color bars into an event box and draw the sliders on the event box 2004-02-21 12:25:09 +00:00
gimperrorconsole.c added missing cast. 2004-02-26 20:04:20 +00:00
gimperrorconsole.h added missing cast. 2004-02-26 20:04:20 +00:00
gimpfiledialog.c eek, the separator crept back in while hacking GimpFileDialog. Removed it 2004-03-04 13:48:35 +00:00
gimpfiledialog.h new function which configures the dialog to load an image. 2004-03-01 13:40:46 +00:00
gimpfontview.c corrected check for number of PDB parameters. Fxes bug #136403. 2004-03-06 21:43:01 +00:00
gimpfontview.h added gimp_container_freeze() / _thaw() around font list reloading. 2003-10-18 16:23:15 +00:00
gimpgradienteditor.c moved the first hint label to a line of its own. fixes bug #127673. 2004-01-19 00:06:18 +00:00
gimpgradienteditor.h added "gboolean data_editable" which gets set in 2003-03-10 14:07:22 +00:00
gimpgrideditor.c set the boundaries for the coordinates widget from the property limits. 2003-11-12 15:15:22 +00:00
gimpgrideditor.h removed "grid_changed" signal. The user of GimpGridEditor can connect to 2003-10-14 12:23:23 +00:00
gimphelp-ids.h updated help IDs for new/reordered pages in the prefs dialog. 2004-01-28 11:06:34 +00:00
gimphelp.c Finished some work that Brix started on the help system. It's now possibly 2004-03-09 01:37:56 +00:00
gimphelp.h Completed the new help infrastructure. Needs some polishing but basically 2003-08-28 18:49:11 +00:00
gimphistogrambox.c put the color bars into an event box and draw the sliders on the event box 2004-02-21 12:25:09 +00:00
gimphistogrambox.h app/widgets/Makefile.am app/widgets/widgets-types.h added new widget 2004-02-19 19:56:04 +00:00
gimphistogrameditor.c put the color bars into an event box and draw the sliders on the event box 2004-02-21 12:25:09 +00:00
gimphistogrameditor.h Replaced the histogram tool by a histogram dialog: 2003-11-01 02:39:34 +00:00
gimphistogramview.c ignore double clicks so we don't grab the pointer away from the curves 2004-02-12 13:12:56 +00:00
gimphistogramview.h draw the selection in GTK_STATE_SELECTED's colors, not inverted. Fixed 2003-12-15 17:40:31 +00:00
gimpimagedock.c #ifdef'ed the code for the global shortcuts and disabled it. 2004-03-03 23:42:50 +00:00
gimpimagedock.h #ifdef'ed the code for the global shortcuts and disabled it. 2004-03-03 23:42:50 +00:00
gimpimageeditor.c app/widgets/gimpdocked.[ch] renamed GimpDockedIface to 2003-10-11 14:30:18 +00:00
gimpimageeditor.h app/widgets/Makefile.am app/widgets/widgets-types.h new GimpEditor 2003-02-20 15:40:15 +00:00
gimpimageview.c Store the zoom factor as float, not as a ratio. 2004-01-29 22:22:29 +00:00
gimpimageview.h app/gui/dialogs-constructors.c app/gui/images-commands.[ch] implemented 2003-11-16 12:07:03 +00:00
gimpitemfactory.c app/widgets/gimpitemfactory.c moved the gimp_menu_position() 2003-11-19 18:08:15 +00:00
gimpitemfactory.h remember the "create_tearoff" passed to gimp_item_factory_new() in the 2003-11-08 18:07:33 +00:00
gimpitemtreeview.c Disallow to rename the layer mask. Instead, always name the mask "<layer 2004-02-01 20:38:26 +00:00
gimpitemtreeview.h To be multihead safe, each new window or menu needs to be associated with 2003-11-08 15:32:38 +00:00
gimplayertreeview.c app/tools/gimpeditselectiontool.c compress undo steps only if the redo 2004-03-02 14:33:31 +00:00
gimplayertreeview.h display the floating selection's name in italic letters. Added the bold 2003-09-06 21:17:16 +00:00
gimpmenudock.c #ifdef'ed the code for the global shortcuts and disabled it. 2004-03-03 23:42:50 +00:00
gimpmenudock.h #ifdef'ed the code for the global shortcuts and disabled it. 2004-03-03 23:42:50 +00:00
gimpmenufactory.c app/widgets/Makefile.am app/widgets/widgets-types.h new widget swallowing 2004-02-27 14:20:19 +00:00
gimpmenufactory.h forgot to commit this my last commit: 2003-09-23 16:26:02 +00:00
gimpmenuitem.c changed drag source stuff to allow multiple data types. Changed DND source 2003-11-20 16:26:15 +00:00
gimpmenuitem.h added vitrual function GimpViewable::get_description() which returns the 2003-04-08 16:01:01 +00:00
gimpnavigationpreview.c app/widgets/gimphistogramview.c destroy GdkGCs in GtkWidget::unrealize(). 2003-11-10 02:00:19 +00:00
gimpnavigationpreview.h added VOID__DOUBLE_DOUBLE 2003-04-01 10:32:03 +00:00
gimpnavigationview.c app/widgets/gimphistogramview.c destroy GdkGCs in GtkWidget::unrealize(). 2003-11-10 02:00:19 +00:00
gimpnavigationview.h added VOID__DOUBLE_DOUBLE 2003-04-01 10:32:03 +00:00
gimppaletteeditor.c marked new strings for translation. 2004-03-04 16:10:57 +00:00
gimppaletteeditor.h app/widgets/gimpdatafactoryview.[ch] app/widgets/gimpitemtreeview.[ch] 2003-09-17 22:54:48 +00:00
gimppreview-popup.c app/widgets/gimpitemfactory.c moved the gimp_menu_position() 2003-11-19 18:08:15 +00:00
gimppreview-popup.h added virtual function get_popup_size() which returns a boolean indicating 2003-02-27 13:59:41 +00:00
gimppreview.c changed drag source stuff to allow multiple data types. Changed DND source 2003-11-20 16:26:15 +00:00
gimppreview.h return early if the widget is not realized to enable destroying the widget 2003-08-13 23:28:26 +00:00
gimppreviewrenderer-utils.c app/widgets/Makefile.am app/widgets/widgets-types.h added new preview 2004-03-03 12:39:19 +00:00
gimppreviewrenderer-utils.h don't scale the preview up if the buffer is too small. 2003-03-01 03:53:41 +00:00
gimppreviewrenderer.c removed the unused GimpViewable parameter from 2003-11-17 13:34:38 +00:00
gimppreviewrenderer.h removed the unused GimpViewable parameter from 2003-11-17 13:34:38 +00:00
gimppreviewrendererbrush.c removed trailing whitespace and #if 0'ed cruft. Cosmetics. 2003-12-21 11:07:40 +00:00
gimppreviewrendererbrush.h removed the constructors with a GimpViewable parameter and always create 2003-03-03 12:59:03 +00:00
gimppreviewrendererdrawable.c removed the unused GimpViewable parameter from 2003-11-17 13:34:38 +00:00
gimppreviewrendererdrawable.h don't scale the preview up if the buffer is too small. 2003-03-01 03:53:41 +00:00
gimppreviewrenderergradient.c added "gboolean reverse" to gimp_gradient_get_color_at() so all gradients 2003-07-22 14:24:11 +00:00
gimppreviewrenderergradient.h Argh, this should have gone with my last checkin... 2003-07-22 14:29:06 +00:00
gimppreviewrendererimage.c themes/Default/images/Makefile.am 2004-01-27 13:48:20 +00:00
gimppreviewrendererimage.h use GIMP_STOCK_IMAGE as default_stock_id. 2003-03-24 14:31:59 +00:00
gimppreviewrendererimagefile.c moved the (disabled) ENABLE_FILE_SYSTEM_ICONS from the .c to the .h file 2004-03-03 14:00:00 +00:00
gimppreviewrendererimagefile.h moved the (disabled) ENABLE_FILE_SYSTEM_ICONS from the .c to the .h file 2004-03-03 14:00:00 +00:00
gimppreviewrendererlayer.c added GIMP_UNDO_TEXT_LAYER to GimpUndoType enum. 2004-01-05 00:28:12 +00:00
gimppreviewrendererlayer.h removed. 2003-09-06 22:02:12 +00:00
gimppreviewrenderervectors.c Accept NULL for ret_closed. 2003-09-30 15:16:51 +00:00
gimppreviewrenderervectors.h "The last of the Oldenburg commits" 2003-09-28 04:00:50 +00:00
gimppropwidgets.c Added infrastructure to make sure we don't write to the global brush, 2004-01-28 21:53:50 +00:00
gimppropwidgets.h Added infrastructure to make sure we don't write to the global brush, 2004-01-28 21:53:50 +00:00
gimpselectioneditor.c Some code review: 2004-02-18 13:43:50 +00:00
gimpselectioneditor.h cleanup. 2003-09-30 02:44:17 +00:00
gimpsessioninfo.c free GimpSessionInfoAux structs using gimp_session_info_aux_free() instead 2003-12-16 18:06:41 +00:00
gimpsessioninfo.h Made session management multiscreen aware: 2003-11-13 15:50:23 +00:00
gimpstrokeeditor.c remove unnecessary GTK_WIDGET() cast. 2004-01-06 10:04:31 +00:00
gimpstrokeeditor.h renamed gimp_prop_size_entry_connect() to gimp_prop_coordinates_connect(). 2003-10-01 19:55:13 +00:00
gimptemplateeditor.c cosmetic. 2004-01-06 11:37:00 +00:00
gimptemplateeditor.h take a guint64 parameter and handle values beyond a gigabyte. 2003-11-14 12:05:13 +00:00
gimptemplateview.c libgimpwidgets/gimpquerybox.c configure the labels in the message dialog 2003-11-14 15:33:40 +00:00
gimptemplateview.h To be multihead safe, each new window or menu needs to be associated with 2003-11-08 15:32:38 +00:00
gimptexteditor.c added missing cast. 2004-02-26 20:04:20 +00:00
gimptexteditor.h added missing cast. 2004-02-26 20:04:20 +00:00
gimpthumbbox.c renamed some members, cleanup. 2004-02-26 16:07:20 +00:00
gimpthumbbox.h renamed some members, cleanup. 2004-02-26 16:07:20 +00:00
gimptoolbox-color-area.c changed drag source stuff to allow multiple data types. Changed DND source 2003-11-20 16:26:15 +00:00
gimptoolbox-color-area.h cleanup & cruft removal. 2003-10-13 12:42:52 +00:00
gimptoolbox-dnd.c Store the zoom factor as float, not as a ratio. 2004-01-29 22:22:29 +00:00
gimptoolbox-dnd.h app/widgets/Makefile.am new files containing the toolbox' drop callbacks. 2003-06-06 15:14:47 +00:00
gimptoolbox-indicator-area.c app/display/gimpdisplayshell-layer-select.c use 2003-11-24 01:23:45 +00:00
gimptoolbox-indicator-area.h g_strdup() the stock_id passed to gimp_tool_info_new() because the 2002-03-14 17:07:02 +00:00
gimptoolbox.c app/config/gimpguiconfig.[ch] app/config/gimprc-blurbs.h 2004-01-16 23:18:23 +00:00
gimptoolbox.h added a container that keeps references to the buttons which are not added 2003-06-11 12:05:00 +00:00
gimptooldialog.c doc fixes. 2003-12-21 10:59:32 +00:00
gimptooldialog.h To be multihead safe, each new window or menu needs to be associated with 2003-11-08 15:32:38 +00:00
gimptooloptionseditor.c added the scrolled window to the GimpToolOptionsEditor struct. 2004-01-30 22:10:31 +00:00
gimptooloptionseditor.h added the scrolled window to the GimpToolOptionsEditor struct. 2004-01-30 22:10:31 +00:00
gimpundoeditor.c Made size of undo previews configurable. Not dynamic for now, but at least 2004-03-07 15:33:04 +00:00
gimpundoeditor.h Made size of undo previews configurable. Not dynamic for now, but at least 2004-03-07 15:33:04 +00:00
gimpvectorstreeview.c To be multihead safe, each new window or menu needs to be associated with 2003-11-08 15:32:38 +00:00
gimpvectorstreeview.h derive it from GimpViewable. 2003-09-27 13:46:30 +00:00
gimpview-popup.c app/widgets/gimpitemfactory.c moved the gimp_menu_position() 2003-11-19 18:08:15 +00:00
gimpview-popup.h added virtual function get_popup_size() which returns a boolean indicating 2003-02-27 13:59:41 +00:00
gimpview.c changed drag source stuff to allow multiple data types. Changed DND source 2003-11-20 16:26:15 +00:00
gimpview.h return early if the widget is not realized to enable destroying the widget 2003-08-13 23:28:26 +00:00
gimpviewablebutton.c app/widgets/gimpcontainerpopup.[ch] let the button remember the popup's 2003-11-18 13:13:57 +00:00
gimpviewablebutton.h app/widgets/gimpcontainerpopup.[ch] let the button remember the popup's 2003-11-18 13:13:57 +00:00
gimpviewabledialog.c added a "role" property. 2003-11-21 14:19:15 +00:00
gimpviewabledialog.h To be multihead safe, each new window or menu needs to be associated with 2003-11-08 15:32:38 +00:00
gimpviewrenderer-utils.c app/widgets/Makefile.am app/widgets/widgets-types.h added new preview 2004-03-03 12:39:19 +00:00
gimpviewrenderer-utils.h don't scale the preview up if the buffer is too small. 2003-03-01 03:53:41 +00:00
gimpviewrenderer.c removed the unused GimpViewable parameter from 2003-11-17 13:34:38 +00:00
gimpviewrenderer.h removed the unused GimpViewable parameter from 2003-11-17 13:34:38 +00:00
gimpviewrendererbrush.c removed trailing whitespace and #if 0'ed cruft. Cosmetics. 2003-12-21 11:07:40 +00:00
gimpviewrendererbrush.h removed the constructors with a GimpViewable parameter and always create 2003-03-03 12:59:03 +00:00
gimpviewrendererdrawable.c removed the unused GimpViewable parameter from 2003-11-17 13:34:38 +00:00
gimpviewrendererdrawable.h don't scale the preview up if the buffer is too small. 2003-03-01 03:53:41 +00:00
gimpviewrenderergradient.c added "gboolean reverse" to gimp_gradient_get_color_at() so all gradients 2003-07-22 14:24:11 +00:00
gimpviewrenderergradient.h Argh, this should have gone with my last checkin... 2003-07-22 14:29:06 +00:00
gimpviewrendererimage.c themes/Default/images/Makefile.am 2004-01-27 13:48:20 +00:00
gimpviewrendererimage.h use GIMP_STOCK_IMAGE as default_stock_id. 2003-03-24 14:31:59 +00:00
gimpviewrendererimagefile.c moved the (disabled) ENABLE_FILE_SYSTEM_ICONS from the .c to the .h file 2004-03-03 14:00:00 +00:00
gimpviewrendererimagefile.h moved the (disabled) ENABLE_FILE_SYSTEM_ICONS from the .c to the .h file 2004-03-03 14:00:00 +00:00
gimpviewrendererlayer.c added GIMP_UNDO_TEXT_LAYER to GimpUndoType enum. 2004-01-05 00:28:12 +00:00
gimpviewrendererlayer.h removed. 2003-09-06 22:02:12 +00:00
gimpviewrenderervectors.c Accept NULL for ret_closed. 2003-09-30 15:16:51 +00:00
gimpviewrenderervectors.h "The last of the Oldenburg commits" 2003-09-28 04:00:50 +00:00
gimpwidgets-constructors.c implementedgimp_int_option_menu_new and gimp_int_radio_group_new, which 2003-11-14 18:05:39 +00:00
gimpwidgets-constructors.h app/core/Makefile.am new file that holds enums that are registered with 2001-12-08 23:12:59 +00:00
gimpwidgets-utils.c set the window icon to the icon displayed in the message dialog. 2004-03-04 13:26:40 +00:00
gimpwidgets-utils.h app/config/gimpguiconfig.[ch] app/config/gimprc-blurbs.h 2004-01-16 23:18:23 +00:00
gtkhwrapbox.c require GTK+ 2.2. The 2.0.x series is no longer maintained, and there are 2003-03-05 22:31:13 +00:00
gtkhwrapbox.h require GTK+ 2.2. The 2.0.x series is no longer maintained, and there are 2003-03-05 22:31:13 +00:00
gtkvwrapbox.c require GTK+ 2.2. The 2.0.x series is no longer maintained, and there are 2003-03-05 22:31:13 +00:00
gtkvwrapbox.h require GTK+ 2.2. The 2.0.x series is no longer maintained, and there are 2003-03-05 22:31:13 +00:00
gtkwrapbox.c Fix wrapped property. 2004-01-12 01:32:20 +00:00
gtkwrapbox.h require GTK+ 2.2. The 2.0.x series is no longer maintained, and there are 2003-03-05 22:31:13 +00:00
Makefile.am app/widgets/Makefile.am app/widgets/widgets-types.h added new preview 2004-03-03 12:39:19 +00:00
makefile.msc updated 2004-03-07 23:13:51 +00:00
widgets-enums.c app/config/gimpguiconfig.[ch] app/config/gimprc-blurbs.h 2004-01-16 23:18:23 +00:00
widgets-enums.h Store the zoom factor as float, not as a ratio. 2004-01-29 22:22:29 +00:00
widgets-types.h app/widgets/Makefile.am app/widgets/widgets-types.h added new preview 2004-03-03 12:39:19 +00:00