Commit graph

1665 commits

Author SHA1 Message Date
Sven Neumann 428a80a1ee removed the "Density" label. It wasn't helpful and caused the transform
2004-10-15  Sven Neumann  <sven@gimp.org>

	* app/tools/gimptransformoptions.c: removed the "Density" label.
	It wasn't helpful and caused the transform options to be wider than
	necessary.

	* app/tools/gimpblendoptions.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimptransformoptions.c: let combo boxes expand
	horizontally like we do in other (all ?) dialogs.

	* app/widgets/gimptemplateeditor.c
	(gimp_template_editor_aspect_callback): update the pixel size label.
2004-10-14 22:55:18 +00:00
Michael Natterer 27c2be7cea libgimpwidgets/gimpwidgets.c app/widgets/gimpenumwidgets.[ch]
2004-10-14  Michael Natterer  <mitch@gimp.org>

	* libgimpwidgets/gimpwidgets.c
	* app/widgets/gimpenumwidgets.[ch]
	* app/widgets/gimppropwidgets.c
	* app/actions/layers-commands.c
	* app/dialogs/convert-dialog.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpcolorbalancetool.c
	* app/tools/gimpcolorizetool.c
	* app/tools/gimpcoloroptions.c
	* app/tools/gimpcurvestool.c
	* app/tools/gimphuesaturationtool.c
	* app/tools/gimpinkoptions-gui.c
	* app/tools/gimplevelstool.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimptransformoptions.c: the child of a GimpFrame must
	not have any border width. Fixes many subtle misalignments.
2004-10-14 15:44:13 +00:00
Michael Natterer eb8ef9fe90 removed the recently added utility functions again.
2004-10-12  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptooloptions-gui.[ch]: removed the recently added
	utility functions again.

	* app/widgets/Makefile.am
	* app/widgets/gimpviewablebox.[ch]
	* app/widgets/gimpwidgets-utils.[ch]: and added cleaned up
	versions here.

	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpclonetool.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimptextoptions.c: changed accordingly.

	* app/dialogs/convert-dialog.c: use gimp_palette_box_new() instead
	of reinventing the wheel.
2004-10-12 12:06:50 +00:00
Michael Natterer 08bab5b31d added utility functions which create a
2004-10-11  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptooloptions-gui.[ch]: added utility functions
	which create a GimpViewableButton+GimpContainerEntry combo for
	brushes, patterns, gradients and fonts and a very ugly utility
	function which packs one of these combos into a GtkFrame returned
	by gimp_prop_enum_radio_frame_new(). This stuff does not really
	belong here but is too ugly to be moved to a more general place.

	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimptextoptions.c: use the new utility functions. Moved
	the pattern previews into the radio frame where using the pattern
	is selected. Make them insensitive if using the pattern is not
	selected.
2004-10-11 13:27:42 +00:00
Michael Natterer 8a622048f3 implement GimpTool::key_press() and cancel the tool on GDK_Escape. Come
2004-10-08  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpmeasuretool.c: implement GimpTool::key_press() and
	cancel the tool on GDK_Escape. Come cleanup.
2004-10-08 15:32:30 +00:00
Michael Natterer 57f9d32e56 Made the text options about two toolbox grid columns smaller. Addresses
2004-10-08  Michael Natterer  <mitch@gimp.org>

	Made the text options about two toolbox grid columns smaller.
	Addresses bug #122862.

	* app/widgets/gimppropwidgets.c (gimp_prop_size_entry_new): use
	the number of digits of the property's max_val plus two as number
	of chars for the sizeentry'y spinbutton (instead of always 10 as
	before).

	* app/tools/gimptextoptions.c (gimp_text_options_gui): GtkEntry
	has a minimal width of 150 pixels (eek). Set a silly small minimal
	width instead (the entry expands to the available width anyway).
2004-10-08 14:00:41 +00:00
Michael Natterer c9f9c56ce7 the gradient button in blend options got lost, added it back. Also moved
2004-10-08  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimppaintoptions-gui.c: the gradient button in blend
	options got lost, added it back. Also moved creation of the brush,
	pattern and gradient buttons to utility functions and cleaned up
	the whole file a bit.
2004-10-08 11:08:50 +00:00
Michael Natterer 76d95a10d0 added new parameter "gboolean propagate_release" to
2004-10-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpeditselectiontool.[ch]: added new parameter
	"gboolean propagate_release" to gimp_edit_slection_tool_start()
	and remember it in the GimpEditSelectionTool struct. If requested,
	propagate GimpTool::button_release() to the tool below in the tool
	stack.

	* app/tools/gimpselectiontool.c (gimp_selection_tool_start_edit):
	pass FALSE so we don't get the button_release().

	* app/tools/gimpmovetool.[ch]: pass TRUE so we get
	button_release(). If moving a layer or path in "pick active" mode,
	remember the old active layer/path and switch back to it in
	button_release(). Fixes bug #97734.

	Unrelated:

	* app/tools/gimpeditselectiontool.c
	(gimp_edit_selection_tool_motion): set "first_move" to FALSE only
	if a move actually happened. Fixes un-undoable moves at high zoom
	factors.
2004-10-06 21:04:13 +00:00
Michael Natterer 62c23a2361 reset the tool options before deserializing so they have the correct
2004-10-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimp-tools.c (gimp_tools_restore): reset the tool
	options before deserializing so they have the correct default
	values. Fixes bug #120832.

	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpmagnifyoptions.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimptransformoptions.c: removed all set_defaults()
	utility functions and moved their code to reset(). The change
	above calls them automatically so there is no need to call them
	from the GUI constructors any more.
2004-10-06 17:21:22 +00:00
Michael Natterer 3f2d5e68b5 Fixed the scale constraints radio buttons:
2004-10-06  Michael Natterer  <mitch@gimp.org>

	Fixed the scale constraints radio buttons:

	* app/tools/gimptransformoptions.c (gimp_transform_options_gui):
	initialize the radio group with the correct value instead of
	resetting the model before creating the group.

	(gimp_scale_options_constrain_callback): change the model
	only if the radio button became active.

	(gimp_scale_options_constrain_notify): new callback which makes
	the radio buttons a real view on the model again (fixes GUI
	updates on modifier press/release).
2004-10-06 12:05:35 +00:00
Michael Natterer dbd941c9f7 dispatch GDK_Escape to GimpTool::key_press().
2004-10-01  Michael Natterer  <mitch@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c
	(gimp_display_shell_tool_events): dispatch GDK_Escape to
	GimpTool::key_press().

	* app/tools/gimpcroptool.c (gimp_crop_tool_key_press)
	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_key_press):
	* app/tools/gimptransformtool.c (gimp_transform_tool_key_press):
	cancel the tool on <Escape>.
2004-10-01 15:15:14 +00:00
Sven Neumann 6e8bb7ac12 destroy the info dialog instead of hiding it. Fixes session management.
2004-10-01  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcroptool.c (crop_response): destroy the info
	dialog instead of hiding it. Fixes session management.
2004-10-01 12:41:54 +00:00
Sven Neumann ef736c43b4 unset the highlight from crop_response() so it gets called when cropping
2004-10-01  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcroptool.c: unset the highlight from
	crop_response() so it gets called when cropping is cancelled.

	* app/dialogs/info-dialog.c (info_dialog_show): do what the
	function name says, show the window, but don't present it.
	Fixes bugs #128833 and #138816.
2004-10-01 12:23:43 +00:00
Sven Neumann 297b53a466 no need to include gimpdisplayshell-render.h here.
2004-10-01  Sven Neumann  <sven@gimp.org>

	* app/display/gimpdisplayshell-callbacks.c: no need to include
	gimpdisplayshell-render.h here.

	* app/display/gimpdisplayshell-draw.c
	* app/display/gimpdisplayshell-render.[ch]

	* app/display/gimpdisplayshell.[ch]: added an API to highlight a
	rectangle (specified in image coordinates). Actually it doesn't
	highlight but dims the area outside the rectangle.

	* app/tools/gimpcroptool.c: use the new functionality to show the
	area to be cropped. Fixes bug #93360.
2004-10-01 09:50:04 +00:00
Sven Neumann ab1045b8a1 plugged a tiny memleak spotted by Olivier.
2004-09-29  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpcropoptions.c (gimp_crop_options_gui): plugged a
	tiny memleak spotted by Olivier.
2004-09-29 15:40:29 +00:00
Sven Neumann 5cc2b3e5f8 simplified code and removed a compiler warning.
2004-09-28  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_settings_dialog):
	simplified code and removed a compiler warning.
2004-09-28 08:23:25 +00:00
Sven Neumann d725502cff add a shortcut to the filechooser that points to the user's folder.
2004-09-28  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_settings_dialog):
	add a shortcut to the filechooser that points to the user's folder.

	* app/actions/vectors-commands.c: added a file filter to the SVG
	import dialog.
2004-09-27 22:44:28 +00:00
Michael Natterer fd8931f2ea set the folder using gtk_file_chooser_set_current_folder(), not
2004-09-24  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpimagemaptool.c
	(gimp_image_map_tool_settings_dialog): set the folder using
	gtk_file_chooser_set_current_folder(), not set_filename().
2004-09-24 14:15:38 +00:00
Sven Neumann 53ff497a93 app/base/curves.[ch] defined CURVES_NUM_POINTS and use it.
2004-09-24  Sven Neumann  <sven@gimp.org>

	* app/base/curves.[ch]
	* app/tools/gimpcurvestool.c: defined CURVES_NUM_POINTS and use it.

	* tools/pdbgen/pdb/color.pdb (curves_spline_invoker): unset the
	last control point which got initialized to (255,255) by
	curves_init(). Fixes bug #153635.

	* app/pdb/color_cmds.c: regenerated.
2004-09-24 13:39:57 +00:00
Michael Natterer ff68106bf1 app/paint/gimpairbrushoptions.c app/paint/gimpcloneoptions.c
2004-09-24  Michael Natterer  <mitch@gimp.org>

	* app/paint/gimpairbrushoptions.c
	* app/paint/gimpcloneoptions.c
	* app/paint/gimpconvolveoptions.c
	* app/paint/gimpdodgeburnoptions.c
	* app/paint/gimperaseroptions.c
	* app/paint/gimpinkoptions.c
	* app/paint/gimppaintoptions.c
	* app/paint/gimppenciloptions.c
	* app/paint/gimpsmudgeoptions.c
	* app/tools/gimpblendoptions.c
	* app/tools/gimpbucketfilloptions.c
	* app/tools/gimpcoloroptions.c
	* app/tools/gimpcolorpickeroptions.c
	* app/tools/gimpcropoptions.c
	* app/tools/gimpflipoptions.c
	* app/tools/gimphistogramoptions.c
	* app/tools/gimpimagemapoptions.c
	* app/tools/gimpmagnifyoptions.c
	* app/tools/gimpmeasureoptions.c
	* app/tools/gimpmoveoptions.c
	* app/tools/gimppaintoptions-gui.c
	* app/tools/gimpselectionoptions.c
	* app/tools/gimptextoptions.c
	* app/tools/gimptransformoptions.c
	* app/tools/gimpvectoroptions.c: code cleanup: untabified and
	trailing whitespace removal, removed empty instance_init()
	funcions, cleaned up variable declarations/initializations.
2004-09-24 12:01:35 +00:00
Michael Natterer db89d80cb1 app/tools/gimpairbrushtool.c (gimp_airbrush_tool_register) add
2004-09-23  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpairbrushtool.c (gimp_airbrush_tool_register)
	* app/tools/gimppenciltool.c (gimp_pencil_tool_register):
	add GIMP_CONTEXT_GRADIENT_MASK to the tools' context_props because
	these tools use the current gradient. Fixes bug #153584.
2004-09-23 21:04:39 +00:00
Michael Natterer 10d80dac75 removed the hack that was displaying "Floating Selection" instead of the
2004-09-22  Michael Natterer  <mitch@gimp.org>

	* app/widgets/gimplayertreeview.c
	(gimp_layer_tree_view_floating_selection_changed): removed the
	hack that was displaying "Floating Selection" instead of the
	floating layer's real name.

	* app/core/gimplayer.c: implement GimpViewable::get_description()
	instead and special case floating selections with a two-line
	text that contains "Floating Selection".

	* app/core/gimplayer-floating-sel.c
	* app/core/gimpimage-undo-push.c: emit "name_changed" on the layer
	when it changes its state from floating to normal or vice versa
	so the views can update accordingly.

	* app/core/gimpselection.c: s/"Selection"/"Floated Layer"/.

	* app/tools/gimpeditselectiontool.c:
	s/"Floating Layer"/"Floating Selection"/.
2004-09-22 12:46:35 +00:00
William Skaggs b8265901d8 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimppaintoptions-gui.c: clean up ugliness introduced
	by my previous commit -- no functional change.
2004-09-19 19:50:09 +00:00
William Skaggs 4b8a00274c Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimppaintoptions-gui.c: rearrange tool options as
	described in bug #153014.
2004-09-19 19:15:03 +00:00
Michael Natterer 7d065360c7 configure.in added new directory app/dialogs and link libappdialogs.c into
2004-09-13  Michael Natterer  <mitch@gimp.org>

	* configure.in
	* app/Makefile.am: added new directory app/dialogs and link
	libappdialogs.c into the gimp binary.

	* app/gui/Makefile.am
	* app/gui/gui-types.h
	* app/gui/gui-vtable.c
	* app/gui/gui.c

	* app/gui/about-dialog.[ch]
	* app/gui/authors.h
	* app/gui/color-notebook.[ch]
	* app/gui/convert-dialog.[ch]
	* app/gui/dialogs-constructors.[ch]
	* app/gui/dialogs.[ch]
	* app/gui/file-dialog-utils.[ch]
	* app/gui/file-new-dialog.[ch]
	* app/gui/file-open-dialog.[ch]
	* app/gui/file-open-location-dialog.[ch]
	* app/gui/file-save-dialog.[ch]
	* app/gui/grid-dialog.[ch]
	* app/gui/info-dialog.[ch]
	* app/gui/info-window.[ch]
	* app/gui/module-browser.[ch]
	* app/gui/offset-dialog.[ch]
	* app/gui/palette-import-dialog.[ch]
	* app/gui/preferences-dialog.[ch]
	* app/gui/quit-dialog.[ch]
	* app/gui/resize-dialog.[ch]
	* app/gui/resolution-calibrate-dialog.[ch]
	* app/gui/stroke-dialog.[ch]
	* app/gui/tips-dialog.[ch]
	* app/gui/tips-parser.[ch]
	* app/gui/user-install-dialog.[ch]: removed these files...

	* app/dialogs/Makefile.am
	* app/dialogs/dialogs-types.h

	* app/dialogs/*.[ch]: ...and added them here. Changed some
	filenames like module-browser -> module-dialog.

	* app/app_procs.c
	* app/actions/actions-types.h
	* app/actions/actions.c
	* app/actions/dialogs-actions.c
	* app/actions/dialogs-commands.c
	* app/actions/dockable-commands.c
	* app/actions/drawable-commands.c
	* app/actions/edit-commands.c
	* app/actions/file-commands.c
	* app/actions/gradient-editor-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/palettes-commands.c
	* app/actions/select-commands.c
	* app/actions/templates-commands.c
	* app/actions/templates-commands.h
	* app/actions/vectors-commands.c
	* app/actions/view-commands.c
	* app/display/gimpdisplayshell-cursor.c
	* app/display/gimpdisplayshell-title.c
	* app/display/gimpdisplayshell.[ch]
	* app/tools/gimpcroptool.c
	* app/tools/gimpperspectivetool.c
	* app/tools/gimprotatetool.c
	* app/tools/gimpscaletool.c
	* app/tools/gimpsheartool.c
	* app/tools/gimptransformtool.[ch]
	* app/tools/gimpvectortool.c
	* app/widgets/gimpcolormapeditor.[ch]
	* app/widgets/gimpcolorpanel.c
	* app/widgets/gimpgradienteditor.[ch]
	* app/widgets/gimppaletteeditor.[ch]
	* app/widgets/gimptoolbox-color-area.c
	* menus/toolbox-menu.xml.in
	* tools/authorsgen/authorsgen.pl: changed accordingly.
2004-09-13 15:15:23 +00:00
Simon Budig c07125554a Fix trailing whitespace introduced by me. /me hides embarrassed in a
2004-09-13  Simon Budig  <simon@gimp.org>

	* app/tools/gimpcroptool.c: Fix trailing whitespace introduced by me.
	/me hides embarrassed in a corner...   :)
2004-09-13 12:02:06 +00:00
Simon Budig ef206e7fd2 Fix warnings and coding style.
2004-09-13  Simon Budig  <simon@gimp.org>

	* app/tools/gimpcroptool.c: Fix warnings and coding style.
2004-09-13 10:10:43 +00:00
Nathan Summers 8be9e2b2be disable crop and resize buttons while the operation is being processed.
2004-09-12  Nathan Summers  <rock@gimp.org>

        * app/tools/gimpcroptool.c: disable crop and resize buttons while the
	operation is being processed.  Fixes #152372.
2004-09-13 01:45:45 +00:00
Simon Budig f7e4e55d1d reordered info_dialog_hide() and crop_tool_crop_image(), which avoids the
2004-09-06  Simon Budig  <simon@gimp.org>

	* app/tools/gimpcroptool.c: reordered info_dialog_hide() and
	crop_tool_crop_image(), which avoids the repeated popping up
	of the info dialog and avoids a crash.

	Fixes bug #151712
2004-09-05 23:42:30 +00:00
Sven Neumann d1825782ea avoid excessive use of strdup() and strcmp(). The strings are all constant
2004-08-30  Sven Neumann  <sven@gimp.org>

	* app/tools/gimpvectortool.[ch] (gimp_vector_tool_status_set):
	avoid excessive use of strdup() and strcmp(). The strings are all
	constant anyway.
2004-08-30 15:08:02 +00:00
David Odin b7f58e163e Renamed GimpPreviewSize to GimpViewSize.
* app/core/core-enums.h: Renamed GimpPreviewSize to GimpViewSize.

* app/core/core-enums.c: Regenerated.

* app/actions/dockable-actions.c

* app/config/gimpcoreconfig.c
* app/config/gimpcoreconfig.h
* app/config/gimpdisplayconfig.c
* app/config/gimpdisplayconfig.h

* app/core/gimpundo.c

* app/display/gimpnavigationeditor.c

* app/gui/dialogs.c
* app/gui/file-open-location-dialog.c

* app/tools/gimppaintoptions-gui.c
* app/tools/gimptextoptions.c

* app/widgets/gimpbrushselect.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdialogfactory.c
* app/widgets/gimpfontselect.c
* app/widgets/gimpgradientselect.c
* app/widgets/gimppaletteselect.c
* app/widgets/gimppatternselect.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpsessioninfo.c
* app/widgets/gimptemplateeditor.c
* app/widgets/gimpundoeditor.c
* app/widgets/gimpundoeditor.h
* app/widgets/gimpviewablebutton.c: Changed accordingly.
2004-08-29 11:58:05 +00:00
David Odin 1622243213 app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.h
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrendererlayer.h
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimppreviewrenderervectors.h: Renamed all these files...

* app/widgets/gimpviewrenderer-utils.c
* app/widgets/gimpviewrenderer-utils.h
* app/widgets/gimpviewrendererbrush.c
* app/widgets/gimpviewrendererbrush.h
* app/widgets/gimpviewrendererdrawable.c
* app/widgets/gimpviewrendererdrawable.h
* app/widgets/gimpviewrenderergradient.c
* app/widgets/gimpviewrenderergradient.h
* app/widgets/gimpviewrendererimage.c
* app/widgets/gimpviewrendererimage.h
* app/widgets/gimpviewrendererimagefile.c
* app/widgets/gimpviewrendererimagefile.h
* app/widgets/gimpviewrendererlayer.c
* app/widgets/gimpviewrendererlayer.h
* app/widgets/gimpviewrenderervectors.c
* app/widgets/gimpviewrenderervectors.h: ... to these names. And also
  changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones.

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpview.c
* app/widgets/widgets-types.h
* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
Sven Neumann 7e18e1f3f8 set the paintbrush as the default tool as suggested in bug #151091.
2004-08-26  Sven Neumann  <sven@gimp.org>

	* app/tools/gimp-tools.c (gimp_tools_register): set the paintbrush
	as the default tool as suggested in bug #151091.
2004-08-26 09:41:18 +00:00
David Odin cddf61a3e6 app/widgets/gimppreview.c renamed these two files to...
* app/widgets/gimppreview.c
* app/widgets/gimppreview.h: renamed these two files to...

* app/widgets/gimpview.c
* app/widgets/gimpview.h: ... these files.

Also renamed GimpPreview to GimpView.
This is the first step of the great Preview->View renaming process.

* app/actions/palettes-commands.c

* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationview.c

* app/gui/palette-import-dialog.c

* app/tools/gimppaintoptions-gui.c

* app/widgets/Makefile.am
* app/widgets/gimpaction.c
* app/widgets/gimpactiongroup.c
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainergridview.h
* app/widgets/gimpdevicestatus.c
* app/widgets/gimpdnd.c
* app/widgets/gimpdockbook.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h
* app/widgets/gimppaletteeditor.c
* app/widgets/gimppreview-popup.c
* app/widgets/gimppropwidgets.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpthumbbox.c
* app/widgets/gimptoolbox-image-area.c
* app/widgets/gimptoolbox-indicator-area.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimpviewabledialog.c
* app/widgets/widgets-types.h: changed accordingly.
2004-08-24 17:16:46 +00:00
David Odin f672ae9169 fixed a typo that broke the build.
* app/tools/tools-utils.c: fixed a typo that broke the build.
2004-08-23 00:45:40 +00:00
Sven Neumann 0c2d88e992 app/tools/Makefile.am added gimp_tool_motion_constrain(),
2004-08-22  Sven Neumann  <sven@gimp.org>

	* app/tools/Makefile.am
	* app/tools/tools-utils.[ch]: added gimp_tool_motion_constrain(),

	* app/paint/gimppaintcore.[ch]: removed gimp_paint_core_constrain().

	* app/tools/gimppainttool.c: changed accordingly.

	* app/tools/gimpblendtool.[ch]: use gimp_tool_motion_constrain()
	instead of duplicating that functionality.

	* app/tools/gimpmeasuretool.c: use gimp_tool_motion_constrain()
	instead of implementing completely different constraints.
2004-08-22 21:48:50 +00:00
Michael Natterer 02d2b990f5 Redid the whole internal progress stuff: don't pass around
2004-08-10  Michael Natterer  <mitch@gimp.org>

	Redid the whole internal progress stuff: don't pass around
	progress_callback and progress_data; instead, provide a
	pointer to a GimpProgressInterface which can be implemented
	by a variety of backends.

	Addresses (but not yet fixes) bugs #6010, #97266 and #135185.

	* app/display/Makefile.am
	* app/display/gimpprogress.[ch]: removed the old progress hack.

	* app/core/Makefile.am
	* app/core/core-types.h
	* app/core/gimpprogress.[ch]: implement GimpProgressInterface.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpprogressdialog.[ch]: the standalone progress
	dialog as widget implementing GimpProgressInterface.

	* app/display/gimpdisplay.c
	* app/display/gimpstatusbar.[ch]
	* app/widgets/gimpfiledialog.[ch]
	* app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface
	implementation to these classes.

	* app/core/gimp-gui.[ch]
	* app/gui/gui-vtable.c: replaced the old progress vtable entries
	by two new to create and destroy a GimpProgressDialog in case
	no other progress is available.

	* app/pdb/procedural_db.[ch]
	* app/plug-in/plug-in-run.[ch]
	* tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and
	all plug-ins.

	* app/plug-in/plug-in.[ch]
	* app/plug-in/plug-ins.c
	* app/plug-in/plug-in-message.c
	* app/plug-in/plug-in-progress.c: handle the case there the
	plug-in was crated with a progress as well as the case where it
	wasn't.

	* app/app_procs.c
	* app/batch.c
	* app/xcf/xcf.c
	* app/file/file-open.[ch]
	* app/file/file-save.[ch]
	* app/widgets/gimphelp.c
	* app/widgets/gimpbrushselect.c
	* app/widgets/gimpfontselect.c
	* app/widgets/gimpgradientselect.c
	* app/widgets/gimppaletteselect.c
	* app/widgets/gimppatternselect.c: changed accordingly.

	* app/core/gimpimagefile.[ch]
	* app/display/gimpdisplayshell-dnd.c
	* app/gui/file-open-dialog.c
	* app/gui/file-open-location-dialog.c
	* app/gui/file-save-dialog.c
	* app/widgets/gimplayertreeview.c
	* app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file
	related functions. Embed the progress in the file dialog where
	possible.

	* app/core/gimpdrawable-blend.[ch]
	* app/core/gimpdrawable-transform.[ch]
	* app/core/gimpimage-convert.[ch]
	* app/core/gimpimage-flip.[ch]
	* app/core/gimpimage-resize.[ch]
	* app/core/gimpimage-rotate.[ch]
	* app/core/gimpimage-scale.[ch]
	* app/core/gimpitem-linked.[ch]
	* app/core/gimpitem.[ch]
	* app/core/gimpchannel.c
	* app/core/gimpdrawable.c
	* app/core/gimplayer.c
	* app/core/gimpselection.c
	* app/vectors/gimpvectors.c: replaced callback/data by GimpProgress.

	* app/tools/gimpblendtool.c
	* app/tools/gimptransformtool.c
	* app/gui/convert-dialog.c
	* app/actions/documents-commands.c
	* app/actions/file-commands.c
	* app/actions/image-commands.c
	* app/actions/layers-commands.c
	* app/actions/plug-in-commands.c
	* app/actions/vectors-commands.c
	* tools/pdbgen/pdb/convert.pdb
	* tools/pdbgen/pdb/edit.pdb
	* tools/pdbgen/pdb/image.pdb
	* tools/pdbgen/pdb/layer.pdb: changed callers accordingly.

	* app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
Michael Natterer da9c039eb2 removed the recently added "gdouble aspect_ratio"...
2004-08-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimptransformtool.h: removed the recently added
	"gdouble aspect_ratio"...

	* app/tools/gimpscaletool.[ch]: ...and added it where it belongs.
2004-08-06 16:39:11 +00:00
Michael Natterer db821565e2 Transform tool cleanup:
2004-08-06  Michael Natterer  <mitch@gimp.org>

	Transform tool cleanup:

	* app/tools/gimptransformtool.[ch]: added new virtual function
	GimpTransformTool::dialog_update().
	Made wrapper for ::recalc() public and function
	transform_bounding_box() private.
	Call ::dialog_update() and transform_bounding_box() from the
	::recalc() wrapper.

	* app/tools/gimpperspectivetool.[ch]
	* app/tools/gimprotatetool.[ch]
	* app/tools/gimpscaletool.[ch]
	* app/tools/gimpsheartool.[ch]: turned all info_dialog update
	functions into GimpTransformTool::dialog_update() implementations
	and don't call them from ::recalc(), also removed calls to
	transform_bounding_box(); both functions are called by the parent
	class now. Call gimp_transform_tool_recalc() when dialog values
	were changed, not the tool's internal function.
	Moved all static variables to the instance structs.
2004-08-06 16:27:13 +00:00
Michael Natterer 42bc755ca7 applied (modified) patch from Ari Pollak which enables controlling the
2004-08-06  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpsheartool.[ch]: applied (modified) patch from Ari
	Pollak which enables controlling the shear direction from the
	dialog and changing the shear direction without hitting "Reset".
	Fixes bug #149467.

	Also moved all static variables to the GimpShearTool struct and
	converted tabs to spaces.
2004-08-06 13:56:34 +00:00
Michael Natterer bba0394529 increased the handle size from 8 to 9 pixels (which is the same as in the
2004-08-05  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpiscissorstool.c: increased the handle size from 8
	to 9 pixels (which is the same as in the path tool) as suggested
	in bug #134250.
2004-08-05 15:44:34 +00:00
Michael Natterer 8db70a4c79 app/tools/gimpscaletool.c applied patch from Jordi Gay (attached to bug
2004-08-05  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpscaletool.c
	* app/tools/gimptransformtool.h: applied patch from Jordi Gay
	(attached to bug #131111) which adds an aspect ratio spinbutton to
	the scale dialog and keeps the aspect ratio intact when with or
	height are changed using the dialog. Fixes bug #132274.

	* app/tools/gimpcroptool.c
	* app/tools/gimpscaletool.c: don't set the aspect spinbuttons to
	"wrap" and decrease their climb_rate.
2004-08-05 11:12:58 +00:00
Sven Neumann 50c962af54 themes/Default/images/Makefile.am removed ...
2004-08-04  Sven Neumann  <sven@gimp.org>

	* themes/Default/images/Makefile.am
	* themes/Default/images/stock-brush-generated-*-16.png: removed ...

	* themes/Default/images/stock-shape-*-16.png: ... and added back
	with more generic names.

	* libgimpwidgets/gimpstock.[ch]
	* app/widgets/gimpbrusheditor.c: changed accordingly.

	* app/tools/gimpinkoptions-gui.c: use the new stock icons here as
	well.

	* app/widgets/Makefile.am
	* app/widgets/widgets-types.h
	* app/widgets/gimpblobeditor.[ch]: added a simple blob shape
	editor widget factored out of app/tools/gimpinkoptions-gui.c.
2004-08-04 18:15:41 +00:00
Michael Natterer b909c2b2ee new function which checks if undo compression is possible:
2004-08-03  Michael Natterer  <mitch@gimp.org>

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_can_compress):
	new function which checks if undo compression is possible:

	(1) is the image dirty? Fixes bug #148853.
	(2) is redo stack empty?
	(3) do both the passed undo object_type and undo_type
	    match the top undo item?

	Consistently name the GType and GimpUndoType passed to undo
	functions "object_type" and "undo_type" to avoid confusion.

	* app/actions/layers-commands.c
	* app/tools/gimpeditselectiontool.c
	* app/tools/gimptexttool.c
	* app/widgets/gimpitemtreeview.c
	* app/widgets/gimplayertreeview.c: use the new utility function
	instead of checking the above conditions manually.
2004-08-03 14:09:49 +00:00
Sven Neumann c6cbd6d335 Applied a bunch of AIX portability fixes (bug #148813):
2004-07-30  Sven Neumann  <sven@gimp.org>

	Applied a bunch of AIX portability fixes (bug #148813):

	* configure.in: when testing for Xmu library, link with -lXt -lX11.

	* app/gui/tips-parser.c
	* app/gui/user-install-dialog.c
	* app/tools/tools-enums.h
	* app/widgets/gimpdasheditor.c
	* app/widgets/widgets-enums.h
	* libgimpthumb/gimpthumb-error.h
	* libgimpwidgets/gimpcolorbutton.c
	* plug-ins/common/edge.c: removed trailing commas from enums.

	* plug-ins/common/snoise.c

	* plug-ins/imagemap/imap_cmd_move.c: no C++ style comments.

	* app/paint-funcs/paint-funcs-generic.h
	* app/paint-funcs/paint-funcs.c: use integers for bit fields.
2004-07-30 00:57:22 +00:00
Michael Natterer 4b582b481a Replaced the concept of having a boolean indicating if an undo step
2004-07-29  Michael Natterer  <mitch@gimp.org>

	Replaced the concept of having a boolean indicating if an undo
	step dirties the image by a bitfield indicating which parts
	of the image are dirtied:

	* app/core/core-enums.[ch]: reordered two values in enum
	GimpUndoType, added GIMP_DIRTY_IMAGE_SIZE to enum GimpDirtyMask.

	The values of GimpDirtyMask are still questionable and will
	probably change...

	* app/core/gimpimage.[ch]: removed signal "undo_start" and added
	a GimpDirtyMask parameter to the "dirty" and "clean" signals.

	* app/core/gimpimage-undo.[ch] (gimp_image_undo_push): replaced
	"gboolean dirties_image" by "GimpDirtyMask dirty_mask" and pass
	it to gimp_image_dirty().

	(gimp_image_undo_group_start): added *ugly* code which tries to
	figure GimpDirtyMask from the group's GimpUndoType and store it in
	the GimpUndoGroup. Call gimp_image_dirty() instead of the removed
	gimp_image_undo_start(). This means the undo group now dirties the
	image just like one of its undo steps, but that's no problem since
	undoing cleans it in the same way.

	* app/core/gimpundo.[ch]: s/dirties_image/dirty_mask/g

	(gimp_undo_pop): emit clean/dirty signals *before* performing the
	actual undo step so listeners can detach from the image before it
	is changed by undo.

	* app/core/gimpimage-undo-push.c (gimp_image_undo_push_*): pass a
	GimpDirtyMask instead of TRUE/FALSE to gimp_image_undo_push().

	* app/core/gimpimagemap.[ch]: removed "gboolean interactive"
	because it makes no sense to use GimpImageMap noninteractively.
	Don't freeze()/thaw() undo while the image_map is active which
	fixes many ways of trashing the image's undo state but probably
	introduces new ways of doing evil things.

	* app/display/gimpdisplay-foreach.c
	* app/display/gimpdisplayshell-handlers.c: changed according
	to the GimpImage::clean()/dirty() signal changes. Small fixes
	in the quit dialog's dirty image container.

	* app/tools/gimptoolcontrol.[ch]: added member and API to
	set/get the dirty_mask.

	* app/tools/gimpcroptool.c
	* app/tools/gimpimagemaptool.c
	* app/tools/gimpiscissorstool.c
	* app/tools/gimptexttool.c
	* app/tools/gimptransformtool.c: whenever setting "preserve" to
	FALSE, also set a "dirty_mask" which specifies on which image
	changes the tool wants to be canceled.

	* app/tools/tool_manager.c: removed "undo_start" connection and
	connect to both "dirty" *and* "clean" to check if the active_tool
	needs to be canceled. Cancel the tool only if the dirty_mask
	passed in the signal has common bits with the tool's dirty_mask.

	Fixes bug #109561 and probably opens some new ones...
2004-07-29 14:16:21 +00:00
Michael Natterer e36039f447 app/tools/gimpbycolorselecttool.c (gimp_by_color_select_tool_init) don't
2004-07-28  Michael Natterer  <mitch@gimp.org>

	* app/tools/gimpbycolorselecttool.c (gimp_by_color_select_tool_init)
	* app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_init):
	don't call gimp_tool_control_set_preserve (tool->control, FALSE)
	because these tools don't cashe any image state and don't care
	about the image changing under their feet.
2004-07-28 16:21:00 +00:00
Michael Natterer ee42d8f506 added still unused flags type GimpDirtyMask.
2004-07-28  Michael Natterer  <mitch@gimp.org>

	* app/core/core-enums.h: added still unused flags type
	GimpDirtyMask.

	* app/base/Makefile.am
	* app/core/Makefile.am
	* app/display/Makefile.am
	* app/paint/Makefile.am
	* app/text/Makefile.am
	* app/tools/Makefile.am
	* app/widgets/Makefile.am
	* libgimpthumb/Makefile.am: changed calls to gimp-mkenums to
	support GTypeFlags and to make the value arrays private to the
	get_type() functions.

	* app/base/base-enums.c
	* app/core/core-enums.c
	* app/display/display-enums.c
	* app/paint/paint-enums.c
	* app/text/text-enums.c
	* app/tools/tools-enums.c
	* app/widgets/widgets-enums.c: regenerated.
2004-07-28 11:50:20 +00:00
Sven Neumann bd427b2e4d libgimpbase/Makefile.am libgimpbase/gimpbase.h libgimpbase/gimpbase.def
2004-07-27  Sven Neumann  <sven@gimp.org>

	* libgimpbase/Makefile.am
	* libgimpbase/gimpbase.h
	* libgimpbase/gimpbase.def
	* libgimpbase/gimpmemsize.[ch]: added new files with memsize
	related functions (moved here from gimputil.c) and
	GIMP_TYPE_MEMSIZE (moved here from app/config/gimpconfig-types.[ch]).

	* libgimpbase/gimputils.[ch]: removed gimp_memsize_to_string() here.

	* libgimpbase/gimpunit.[ch]: added GIMP_TYPE_UNIT (moved here from
	app/config/gimpconfig-types.[ch]).

	* libgimpbase/gimpbase-private.c
	* libgimp/gimptile.c
	* libgimp/gimpunitcache.c
	* plug-ins/help/domain.c
	* app/xcf/xcf-read.c: need to include glib-object.h.

	* plug-ins/common/uniteditor.c: use GIMP_TYPE_UNIT.

	* app/config/gimpconfig-types.[ch]: removed code that lives in
	libgimpbase now.

	* app/config/gimpconfig-deserialize.c: changed accordingly.

	* app/config/gimpbaseconfig.c
	* app/config/gimpdisplayconfig.c
	* app/core/gimpcontext.c
	* app/gui/grid-dialog.c
	* app/tools/gimpcolortool.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpunitstore.c: no need to include gimpconfig-types.h
	any longer.
2004-07-27 16:39:00 +00:00
Michael Natterer caabe7f334 removed GIMP_TYPE_COLOR.
2004-07-26  Michael Natterer  <mitch@gimp.org>

	* app/config/gimpconfig-types.h: removed GIMP_TYPE_COLOR.

	* app/config/gimpconfig-params.[ch]: renamed GimpParamSpecColor
	to GimpParamSpecRGB.

	* app/config/gimpconfig-deserialize.c
	* app/config/gimpconfig-dump.c
	* app/config/gimpconfig-serialize.c
	* app/config/gimpscanner.c
	* app/core/gimp-utils.c
	* app/core/gimpcontext.c
	* app/core/gimpgrid.c
	* app/display/gimpdisplayoptions.c
	* app/text/gimptext.c
	* app/tools/gimpcolortool.c
	* app/widgets/gimpaction.c
	* app/widgets/gimpcolorbar.c
	* app/widgets/gimppropwidgets.c: changed accordingly.
2004-07-26 19:56:47 +00:00