gimp/app/widgets/Makefile.am

334 lines
8.1 KiB
Makefile
Raw Normal View History

## Process this file with automake to produce Makefile.in
AM_CPPFLAGS = \
-DG_LOG_DOMAIN=\"Gimp-Widgets\" \
@GTHREAD_CFLAGS@
INCLUDES = \
-I$(top_builddir) \
-I$(top_srcdir) \
-I$(top_builddir)/app \
-I$(top_srcdir)/app \
$(GTK_CFLAGS) \
$(PANGOFT2_CFLAGS) \
-I$(includedir)
noinst_LIBRARIES = libappwidgets.a
libappwidgets_a_sources = \
widgets-enums.h \
widgets-types.h \
gimpaction.c \
gimpaction.h \
gimpactionfactory.c \
gimpactionfactory.h \
gimpactiongroup.c \
gimpactiongroup.h \
gimpactionview.c \
gimpactionview.h \
gimpblobeditor.c \
gimpblobeditor.h \
gimpbrusheditor.c \
gimpbrusheditor.h \
removed GimpFillType. 2001-06-29 Michael Natterer <mitch@gimp.org> * app/appenums.h: removed GimpFillType. * app/gimprc.c: parse the session-info's new "aux-info" field. * app/global_edit.[ch]: removed the old "Paste Named" dialog and prefixed all functions with "gimp_". * app/core/core-types.h: added GimpFillType. * app/core/gimpbrush.[ch]: new signal "spacing_changed". * app/gui/Makefile.am * app/gui/tools-commands.[ch]: one more file cut out of commands.[ch]. * app/gui/commands.[ch]: removed the tools stuff here. * app/gui/brush-select.[ch] * app/gui/dialogs-constructors.c: use the new GimpBrushFactoryView (see below). * app/gui/dialogs-commands.[ch] * app/gui/menus.[ch]: - Made it 64bit safe again by passing the dialog factory's identifiers as GQuarks, not as guints created by GPOINTER_TO_UINT(). - Added a "gchar *quark_string" field to GimpItemFactoryEntry which gets transformed into a GQuark by menus_create_item(). - Added SEPARATOR() and BRANCH() macros which make the *_entries[] arrays more readable. - Added a menu item to show/hide GimpImageDock's image menu. - Removed file_last_opened_cmd_callback(). * app/gui/edit-commands.c: the global_edit functions are "gimp_" prefixed now. * app/gui/file-commands.[ch]: added file_last_opened_cmd_callback() here. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpbrushfactoryview.[ch]: new widget: a GimpDataFactory subclass with a "spacing" scale. * app/widgets/gimpcontainereditor.[ch]: - Connect to the GimpContainerView's "select_item", "activate_item" and "context_item" signals here once instead of in each subclass and dispatch them via new virtual functions. - Added a convenience function which makes DND to the buttons much less painful for subclasses. * app/widgets/gimpbufferview.c * app/widgets/gimpdatafactoryview.[ch]: changed accordingly. * app/widgets/gimpdialogfactory.[ch]: - Added gimp_dialog_factory_dialog_raise() which can raise toplevel dialogs _and_ dockables (and creates them if they are not open yet). - Keep track of all created dialogs (not only toplevels). - Added an "aux_info" field to GimpSessionInfo which is a GList of gchar* and is saved in sessionrc. - Remember if GimpImageDock's image menu is visible by using an aux_info string. - The code did not become nicer with all those new constraints. I have to add comments before I forget how it works. * app/widgets/gimpdockbook.c: set the state of the "Show Image Menu" menu item before popping up the item factory. * app/widgets/gimpimagedock.[ch]: added gimp_image_dock_set_show_image_meu(). * plug-ins/gdyntext/gdyntext.c * plug-ins/perl/examples/fit-text * plug-ins/perl/examples/terral_text * plug-ins/perl/examples/tex-to-float: register all text rendering plug-ins under <Image>/Filters/Text * app/pdb/brush_select_cmds.c * app/pdb/drawable_cmds.c * app/pdb/edit_cmds.c * tools/pdbgen/pdb/brush_select.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/enums.pl * po/POTFILES.in: changed according to all the stuff above.
2001-06-29 19:25:03 +00:00
gimpbrushfactoryview.c \
gimpbrushfactoryview.h \
gimpbrushselect.c \
gimpbrushselect.h \
app/Makefile.am removed. 2001-06-26 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/color_transfer.[ch]: removed. * app/tools/Makefile.am * app/tools/gimpcolorbalancetool-transfer.[ch]: added. * app/tools/gimpcolorbalancetool.c: changed accordingly. * app/base/Makefile.am * app/base/tile-manager-crop.[ch]: formerly known as crop_buffer(). * app/tools/gimptexttool.c: changed accordingly. * app/context_manager.[ch]: added the global clipboard and the named buffer list here. * app/app_procs.c: don't call color_transfer_init() and don't free the buffer stuff (done by the context manager now). * app/errorconsole.c: don't #include "gui/commands.h" * app/global_edit.[ch]: removed lots of stuff which is now done by gui/edit-commands.* or the new GimpBuffer object. The "paste named" dialog will go away and this file will be moved to core/ soon. * app/image_new.c: no need to declare the global_buffer extern any more. * app/qmask.c: don't #include "global_edit.h" * app/core/Makefile.am * app/core/core-types.h * app/core/gimpbuffer.[ch]: new object (aka named buffer) * app/core/gimpcontext.[ch]: added a GimpBuffer attribute. * app/core/gimpimage.[ch]: one s/int/gboolean/. * app/core/gimppattern.c: hmm... * app/gui/commands.[ch]: split up in small files: * app/gui/Makefile.am * app/gui/edit-commands.[ch] * app/gui/file-commands.[ch] * app/gui/image-commands.[ch] * app/gui/select-commands.[ch] * app/gui/view-commands.[ch]: new files. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c: added the named buffer list & grid. * app/gui/file-new-dialog.[ch] * app/gui/menus.c * app/gui/palette-editor.c * app/gui/test-commands.c: changed accordingly. * app/pdb/edit_cmds.c * tools/pdbgen/pdb/edit.pdb: changed for the global_edit stuff. * app/widgets/Makefile.am * app/widgets/gimpbufferpreview.[ch] * app/widgets/gimpbufferview.[ch] * app/widgets/gimpcontainereditor.[ch]: new widgets. * app/widgets/gimpcontainerview-utils.c * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawablepreview.c * app/widgets/gimplayerlistview.c * app/widgets/gimppreview.c * app/widgets/widgets-types.h: changed accordingly for the new GimpBuffer object and it's views, misc. cleanups. * pixmaps/Makefile.am * pixmaps/paste-as-new.xpm * pixmaps/paste-into.xpm * pixmaps/paste.xpm: new pixmaps (they all look the same... Tigert? ;-) * po/POTFILES.in: added the new files.
2001-06-26 12:09:43 +00:00
gimpbufferview.c \
gimpbufferview.h \
gimpcellrendereraccel.c \
gimpcellrendereraccel.h \
gimpcellrendererdashes.c \
gimpcellrendererdashes.h \
added "gchar *stock_id" to the GimpViewable struct. It is used by the GUI 2003-02-26 Michael Natterer <mitch@gimp.org> * app/core/gimpviewable.[ch]: added "gchar *stock_id" to the GimpViewable struct. It is used by the GUI if the get_preview() functions return NULL. Default to GTK_STOCK_DIALOG_QUESTION. * app/core/gimptoolinfo.[ch]: set the tool's stock_id. Removed the cached GdkPixbuf. Don't implement any preview function so the GUI uses the stock_id. * app/tools/tool_manager.c: removed GdkPixbuf creation, removed the #warning about the buggy way we created the pixbuf. * app/gui/dialogs-constructors.c * app/gui/image-menu.c * app/tools/gimpcroptool.c * app/tools/gimphistogramtool.c * app/tools/gimpimagemaptool.c * app/tools/gimpmeasuretool.c * app/tools/gimptransformtool.c * app/widgets/gimptoolbox.c: use viewable->stock_id instead of tool_info->stock_id. * app/core/gimpbrush.c * app/core/gimpgradient.c * app/core/gimpimagefile.c * app/core/gimpundo.c: simplified get_preview() implementations: - never scale previews up, only down. - don't render white or checks backgrounds but simply return TempBufs with alpha and let the preview system do its job. - don't add padding but simply return previews smaller than requested. * app/display/gimpdisplayshell-render.[ch]: added "render_blend_white", a 2d lookup table for blending on white, just as the check lookup tables. Added "render_white_buf". * app/widgets/gimppreview.[ch]: changed a lot: - don't render the preview's border into the buffer. - added "GdkGC *border_gc" and draw the preview's border in expose() using gdk_draw_rectangle(). - added "GdkPixbuf *no_preview_pixbuf" and create it in gimp_preview_real_render() if gimp_viewable_get_preview() returned NULL. - factored the actual preview rendering out to gimp_preview_render_to_buffer(). Added configurable background rendering for the preview itself and it's padding area (the area the preview is larger than the buffer returned by gimp_viewable_get_preview()). - changed gimp_preview_render_and_flush() to gimp_preview_render_preview() and added "inside_bg" and "outside_bg" parameters. - use the new render buffers for blending on white. * app/widgets/gimpbrushpreview.c * app/widgets/gimpbufferpreview.c * app/widgets/gimpdrawablepreview.c * app/widgets/gimpgradientpreview.c * app/widgets/gimpimagepreview.c * app/widgets/gimppalettepreview.c * app/widgets/gimppatternpreview.c: don't create large white TempBufs to center the previews in but simply set the TempBuf's offsets to get them centered. Simplified & cleaned up many preview render functions. Pass the correct GimpPreviewBG modes to gimp_preview_render_preview(). * app/widgets/gimpcellrendererviewable.[ch]: new GtkCellRenderer class derived from GtkCellRendererPixbuf which knows how to use gimp_viewable_get_preview_size() and renders the viewable's stock item if no preview can be created. * app/widgets/gimpcontainertreeview.c: added a GtkTreeCellDataFunc which creates the preview pixbuf if needed so we don't create it unconditionally upon item insertion. Fixed preview size assertion to use GIMP_PREVIEW_MAX_SIZE, not "64". Block "selection_changed" while reordering the selected item. * app/widgets/gimpcontainerview.c: cosmetic. * app/widgets/gimpimagefilepreview.[ch] * app/widgets/gimptoolinfopreview.[ch] * app/widgets/gimpundopreview.[ch]: removed because the default implementation is good enough. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimppreview-utils.c: changed accordingly. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs-menu.c * app/gui/dialogs.c * app/gui/image-menu.c * app/gui/toolbox-menu.c: register grid and tree view variants of the document history. Unrelated: * app/gui/gui.c (gui_exit_finish_callback): disconnect from signals earlier. * app/gui/user-install-dialog.c: create the "tool-options" subdir of the user's ~/.gimp-1.3 directory.
2003-02-26 16:17:10 +00:00
gimpcellrendererviewable.c \
gimpcellrendererviewable.h \
Added GtkTreeView versions of layers/channels/vectors: 2003-03-16 Michael Natterer <mitch@gimp.org> Added GtkTreeView versions of layers/channels/vectors: * app/core/core-enums.[ch]: renamed GIMP_UNDO_GROUP_LAYER_PROPERTIES to GIMP_UNDO_GROUP_ITEM_PROPERTIES. * app/core/gimpcontainer.c (gimp_container_reorder): don't try to reorder containers with num_children == 1. * app/core/gimpmarshal.list: added VOID: STRING, UINT marshaller. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpchanneltreeview.[ch] * app/widgets/gimpdrawabletreeview.[ch] * app/widgets/gimpitemtreeview.[ch] * app/widgets/gimplayertreeview.[ch] * app/widgets/gimpvectorstreeview.[ch]: new widgets. * app/widgets/gimpcellrenderertoggle.c: draw the frame only if the cell is prelit. * app/widgets/gimpcellrendererviewable.[ch]: added "clicked" signal, unref the renderer in finalize(). Set the renderer's border color to black if the cell is not selected (a hack that saves tons of code in GimpLayerTreeView). * app/widgets/gimpcomponenteditor.c: no need to gtk_list_store_set() stuff we just got from the store. * app/widgets/gimpcontainertreeview.[ch]: added lots of state used by the new subclasses to the GimpContainerTreeView struct. Create the GtkListStore/GtkTreeView in GObject::constructor() and only collect parameters in init() so subclasses can modify store/view creation. Do most of the button_press_event stuff manually and return TRUE from the handler. * app/widgets/gimpcontainerview.c: cleanup. * app/widgets/gimpitemlistview.h * app/widgets/gimpvectorslistview.h: temp hacks before they die. * app/widgets/gimppreviewrenderer.[ch]: added gimp_preview_renderer_update_idle() which idle-emits "update" without invalidating. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c: added constructors for the new dialogs. * app/gui/channels-commands.c * app/gui/channels-menu.c * app/gui/layers-commands.c * app/gui/layers-menu.c * app/gui/vectors-commands.c * app/gui/vectors-menu.c: accept tree views as callback data.
2003-03-16 11:14:29 +00:00
gimpchanneltreeview.c \
gimpchanneltreeview.h \
gimpclipboard.c \
gimpclipboard.h \
gimpcolorbar.c \
gimpcolorbar.h \
gimpcolordialog.c \
gimpcolordialog.h \
gimpcolordisplayeditor.c \
gimpcolordisplayeditor.h \
added virtual functions set_toggles_visible() and set_toggles_sensitive(). 2002-11-05 Michael Natterer <mitch@gimp.org> * libgimpwidgets/gimpcolorselector.[ch]: added virtual functions set_toggles_visible() and set_toggles_sensitive(). Added a stock_id. Emit "color_changed" and "channel_changed" on set_color() and set_channel() resp. * libgimpwidgets/gimpcolornotebook.[ch]: implement the new methods. Added gimp_color_notebook_set_has_page() to control which selectors a notebook contains. * libgimpwidgets/gimpcolorscales.[ch]: removed the toggle API and implement the new methods. * libgimpwidgets/gimpcolorselect.c: added toggle buttons for the channels so the widget doesn't need external ones. * app/gui/color-notebook.c: changed accordingly. * libgimpwidgets/gimpstock.[ch] * themes/Default/images/Makefile.am * themes/Default/images/stock-color-triangle-16.png: added a (bad) icon for the triangle color selector. * modules/colorsel_triangle.c: use the new icon. * modules/colorsel_water.c: use the "Paintbrush" icon for now. * app/widgets/gimpcoloreditor.[ch]: new widget for editing the FG/BG color featuring a color notebook, stock buttons for selecting the pages and a GimpPickButton. * app/widgets/Makefile.am * app/widgets/widgets-types.h: changed accordingly. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c: added a dockable wrapper for GimpColorEditor. * app/gui/menus.c: added it to the menus. Also added separate Layers, Channels and Paths entries. Bind <ctrl>L to the new callback so it doesn't always create a new layers dialog.
2002-11-05 00:02:56 +00:00
gimpcoloreditor.c \
gimpcoloreditor.h \
gimpcolorframe.c \
gimpcolorframe.h \
gimpcolormapeditor.c \
gimpcolormapeditor.h \
2001-04-11 01:13:53 +00:00
gimpcolorpanel.c \
gimpcolorpanel.h \
gimpcomponenteditor.c \
gimpcomponenteditor.h \
gimpcontainerbox.c \
gimpcontainerbox.h \
gimpcontainercombobox.c \
gimpcontainercombobox.h \
app/Makefile.am removed. 2001-06-26 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/color_transfer.[ch]: removed. * app/tools/Makefile.am * app/tools/gimpcolorbalancetool-transfer.[ch]: added. * app/tools/gimpcolorbalancetool.c: changed accordingly. * app/base/Makefile.am * app/base/tile-manager-crop.[ch]: formerly known as crop_buffer(). * app/tools/gimptexttool.c: changed accordingly. * app/context_manager.[ch]: added the global clipboard and the named buffer list here. * app/app_procs.c: don't call color_transfer_init() and don't free the buffer stuff (done by the context manager now). * app/errorconsole.c: don't #include "gui/commands.h" * app/global_edit.[ch]: removed lots of stuff which is now done by gui/edit-commands.* or the new GimpBuffer object. The "paste named" dialog will go away and this file will be moved to core/ soon. * app/image_new.c: no need to declare the global_buffer extern any more. * app/qmask.c: don't #include "global_edit.h" * app/core/Makefile.am * app/core/core-types.h * app/core/gimpbuffer.[ch]: new object (aka named buffer) * app/core/gimpcontext.[ch]: added a GimpBuffer attribute. * app/core/gimpimage.[ch]: one s/int/gboolean/. * app/core/gimppattern.c: hmm... * app/gui/commands.[ch]: split up in small files: * app/gui/Makefile.am * app/gui/edit-commands.[ch] * app/gui/file-commands.[ch] * app/gui/image-commands.[ch] * app/gui/select-commands.[ch] * app/gui/view-commands.[ch]: new files. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c: added the named buffer list & grid. * app/gui/file-new-dialog.[ch] * app/gui/menus.c * app/gui/palette-editor.c * app/gui/test-commands.c: changed accordingly. * app/pdb/edit_cmds.c * tools/pdbgen/pdb/edit.pdb: changed for the global_edit stuff. * app/widgets/Makefile.am * app/widgets/gimpbufferpreview.[ch] * app/widgets/gimpbufferview.[ch] * app/widgets/gimpcontainereditor.[ch]: new widgets. * app/widgets/gimpcontainerview-utils.c * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawablepreview.c * app/widgets/gimplayerlistview.c * app/widgets/gimppreview.c * app/widgets/widgets-types.h: changed accordingly for the new GimpBuffer object and it's views, misc. cleanups. * pixmaps/Makefile.am * pixmaps/paste-as-new.xpm * pixmaps/paste-into.xpm * pixmaps/paste.xpm: new pixmaps (they all look the same... Tigert? ;-) * po/POTFILES.in: added the new files.
2001-06-26 12:09:43 +00:00
gimpcontainereditor.c \
gimpcontainereditor.h \
gimpcontainerentry.c \
gimpcontainerentry.h \
gimpcontainergridview.c \
cleanup. 2001-04-22 Michael Natterer <mitch@gimp.org> * app/Makefile.am: cleanup. * app/interface.c: #include "gimpui.h" * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c * app/gui/menus.c * app/gui/test-commands.[ch]: changes for the image menu below. * app/apptypes.h * app/widgets/Makefile.am * app/widgets/gimpcontainermenu.[ch] * app/widgets/gimpcontainermenuimpl.[ch]: new widgets. The actual implemtation lives in a separate file because gimpcontainermenu.c's code is identical to gimpcontainerview.c's except for the base class. This will become an interface with Gtk 2.0. * app/widgets/gimpimagedock.[ch]: a dock with an image menu. The pages still don't follow the context correctly. * app/widgets/gimpmenuitem.[ch]: a menu item with a preview. * app/widgets/gimpdialogfactory.[ch]: pass a dock constructor to the constructor and provide a method to create a new dock within this factory's context. * app/widgets/gimpdock.[ch]: removed the constructor because we create only image docks now. Put the vbox into a main_vbox (which also contains the image menu). * app/widgets/gimpdockbook.[ch]: create new docks with the dialog factory. * app/gimpcontainer.[ch] * app/gimpdata.[ch] * app/gimpdatafactory.[ch] * app/gimpdatalist.[ch] * app/gimplist.[ch] * app/gimpviewable.[ch] * app/widgets/gimpbrushpreview.[ch] * app/widgets/gimpcontainergridview.[ch] * app/widgets/gimpcontainerlistview.[ch] * app/widgets/gimpcontainerview.[ch] * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpdockable.[ch] * app/widgets/gimpdrawablelistitem.[ch] * app/widgets/gimpdrawablelistview.[ch] * app/widgets/gimpdrawablepreview.[ch] * app/widgets/gimplayerlistitem.[ch] * app/widgets/gimplayerlistview.[ch] * app/widgets/gimplistitem.[ch] * app/widgets/gimppalettepreview.[ch] * app/widgets/gimppatternpreview.[ch] * app/widgets/gimppreview.[ch]: ass-sign some copyrights.
2001-04-22 00:38:56 +00:00
gimpcontainergridview.h \
gimpcontainerpopup.c \
gimpcontainerpopup.h \
Started migration from GtkList to GtkTreeView: 2003-02-21 Michael Natterer <mitch@gimp.org> Started migration from GtkList to GtkTreeView: * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpcontainertreeview.[ch]; new GimpContainerView subclass using GtkListStore/GtkTreeView. * app/widgets/widgets-enums.h: added GIMP_VIEW_TYPE_TREE to thje GimpViewType enum. * app/widgets/gimpcontainereditor.c: added GimpContainerTreeView to the switch() which selects the view type. * app/gui/dialogs-commands.c * app/gui/dialogs-constructors.[ch] * app/gui/dialogs-menu.c * app/gui/dialogs.c: added tree view versions of many dialogs. * app/widgets/gimppreview.[ch]: removed the get_size() virtual function and gimp_preview_calc_size(). * app/core/gimpviewable.[ch]: added virtual function get_preview_size() and gimp_viewable_calc_preview_size(). * app/core/gimpbuffer.c * app/core/gimpdrawable-preview.[ch] * app/core/gimpdrawable.c * app/core/gimpgradient.c * app/core/gimpimage.c * app/core/gimppalette.c: added get_preview_size() implementations. * app/widgets/gimpbufferpreview.c * app/widgets/gimpdrawablepreview.c * app/widgets/gimpgradientpreview.c * app/widgets/gimpimagepreview.c * app/widgets/gimppalettepreview.c * app/widgets/gimpselectioneditor.c * app/widgets/gimpundopreview.c * app/display/gimpnavigationview.c: changed accordingly, removed get_size() implementations. * app/widgets/widgets-types.h: changed the first param of GimpItemGetNameFunc from GtkWidget to GObject. * app/widgets/gimpcontainerview-utils.c: accept a GimpViewable as object in the built-in get_name funcs. * app/widgets/gimpcomponentlistitem.c * app/widgets/gimpcontainergridview.c * app/widgets/gimplistitem.c * app/widgets/gimpmenuitem.c: changed accordingly.
2003-02-21 19:03:19 +00:00
gimpcontainertreeview.c \
gimpcontainertreeview.h \
gimpcontainertreeview-dnd.c \
gimpcontainertreeview-dnd.h \
gimpcontainerview.c \
cleanup. 2001-04-22 Michael Natterer <mitch@gimp.org> * app/Makefile.am: cleanup. * app/interface.c: #include "gimpui.h" * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c * app/gui/menus.c * app/gui/test-commands.[ch]: changes for the image menu below. * app/apptypes.h * app/widgets/Makefile.am * app/widgets/gimpcontainermenu.[ch] * app/widgets/gimpcontainermenuimpl.[ch]: new widgets. The actual implemtation lives in a separate file because gimpcontainermenu.c's code is identical to gimpcontainerview.c's except for the base class. This will become an interface with Gtk 2.0. * app/widgets/gimpimagedock.[ch]: a dock with an image menu. The pages still don't follow the context correctly. * app/widgets/gimpmenuitem.[ch]: a menu item with a preview. * app/widgets/gimpdialogfactory.[ch]: pass a dock constructor to the constructor and provide a method to create a new dock within this factory's context. * app/widgets/gimpdock.[ch]: removed the constructor because we create only image docks now. Put the vbox into a main_vbox (which also contains the image menu). * app/widgets/gimpdockbook.[ch]: create new docks with the dialog factory. * app/gimpcontainer.[ch] * app/gimpdata.[ch] * app/gimpdatafactory.[ch] * app/gimpdatalist.[ch] * app/gimplist.[ch] * app/gimpviewable.[ch] * app/widgets/gimpbrushpreview.[ch] * app/widgets/gimpcontainergridview.[ch] * app/widgets/gimpcontainerlistview.[ch] * app/widgets/gimpcontainerview.[ch] * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpdockable.[ch] * app/widgets/gimpdrawablelistitem.[ch] * app/widgets/gimpdrawablelistview.[ch] * app/widgets/gimpdrawablepreview.[ch] * app/widgets/gimplayerlistitem.[ch] * app/widgets/gimplayerlistview.[ch] * app/widgets/gimplistitem.[ch] * app/widgets/gimppalettepreview.[ch] * app/widgets/gimppatternpreview.[ch] * app/widgets/gimppreview.[ch]: ass-sign some copyrights.
2001-04-22 00:38:56 +00:00
gimpcontainerview.h \
gimpcontainerview-utils.c \
gimpcontainerview-utils.h \
gimpcontrollereditor.c \
gimpcontrollereditor.h \
gimpcontrollerinfo.c \
gimpcontrollerinfo.h \
gimpcontrollerlist.c \
gimpcontrollerlist.h \
gimpcontrollers.c \
gimpcontrollers.h \
gimpcontrollerkeyboard.c \
gimpcontrollerkeyboard.h \
gimpcontrollerwheel.c \
gimpcontrollerwheel.h \
app/Makefile.am removed. Stuff now lives in app_procs.[ch] and in 2001-05-13 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/cursorutil.[ch]: removed. Stuff now lives in app_procs.[ch] and in widgets/gimpcursor.[ch] * app/appenv.h: added the "gimp_busy" boolean. * app/app_procs.[ch]: added the "busy" stuff here. * app/gui/gui.[ch]: "busy" stuff for the gui. * app/widgets/Makefile.am * app/widgets/gimpcursor.[ch]: exports only one function: gimp_cursor_new() which returns a GdkCursor which has to be destroyed. * app/apptypes.h * app/appenums.h: removed the cursor types. * app/widgets/widgets-types.h: added here. * app/tools/gimpeditselectiontool.[ch]: added gtkutil_compress_motion() here (will go to some utils file in widgets/). * app/tools/tools-types.h: #include "widgets/widgets-types.h" * app/dialog_handler.c * app/disp_callbacks.c * app/gdisplay.[ch] * app/nav_window.c * app/scroll.c * app/xcf.c * app/core/gimpimage-convert.c * app/core/gimpimage-duplicate.c * app/core/gimpimage.c * app/gui/file-open-dialog.c * app/tools/gimpblendtool.c * app/tools/gimpbucketfilltool.c * app/tools/gimpcroptool.c * app/tools/gimpfuzzyselecttool.c * app/tools/gimptransformtool.c * tools/pdbgen/pdb/image.pdb * app/pdb/image_cmds.c: use the new cursor and "busy" functions. * app/gdisplay.h * app/core/gimpbrush.c: added some ugly cross-includes. * app/context_manager.c * app/gdisplay_ops.c * app/gimprc.c * app/core/gimpdrawable-offset.c * app/gui/file-save-dialog.c * app/gui/gradient-editor.c * app/gui/preferences-dialog.c * app/tools/gimpbezierselecttool.c * app/tools/gimpbycolorselecttool.c * app/tools/gimpclonetool.c * app/tools/gimpcolorpickertool.c * app/tools/gimperasertool.c * app/tools/gimpfliptool.c * app/tools/gimpinktool.c * app/tools/gimpiscissorstool.c * app/tools/gimpmagnifytool.c * app/tools/gimpmeasuretool.c * app/tools/gimpmovetool.c * app/tools/gimppainttool.c * app/tools/gimprectselecttool.c * app/tools/gimprotatetool.c * app/tools/gimpselectiontool.c: removed inclusion of "cursorutil.h"
2001-05-13 21:51:20 +00:00
gimpcursor.c \
gimpcursor.h \
added new signals "sample-point-added" and "sample-point-removed" and 2005-04-03 Michael Natterer <mitch@gimp.org> * app/core/gimpimage.[ch]: added new signals "sample-point-added" and "sample-point-removed" and public functions to emit them. * app/core/gimpimage-sample-points.c (gimp_image_add_sample_point) (gimp_image_remove_sample_point): emit them accordingly. * app/core/gimpimage-undo-push.c (undo_pop_image_sample_point): ditto. (undo_pop_image_guide) (undo_pop_image_sample_point): added comments why we add/remove stuff manually instead of using the GimpImage APIs. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpcursorview.[ch] * app/widgets/gimpsamplepointeditor.[ch]: new widgets. GimpCursorView is a replacement for the info window's "Cursor" page, GimpSamplePointEditor is a view on an image's sample points. The sample point editor does nothing yet except keeping a 2x2 grid of GimpColorFrames. Addresses bug #137776. * app/dialogs/dialogs.c * app/dialogs/dialogs-constructors.[ch]: register the new widgets as dockable dialogs. * app/actions/dialogs-actions.c (dialogs_dockable_actions) * menus/dialogs-menuitems.xml: added actions and menu items for the new dialogs. * app/display/gimpdisplayshell-cursor.c (gimp_display_shell_update_cursor) (gimp_display_shell_clear_cursor): update the new cursor view. * app/widgets/gimphelp-ids.h: help IDs for the new dialogs. * app/widgets/widgets-enums.[ch] (enum GimpColorFrameMode): changed description "Pixel values" to "Pixel" because the former was too long.
2005-04-03 15:48:03 +00:00
gimpcursorview.c \
gimpcursorview.h \
gimpdasheditor.c \
gimpdasheditor.h \
gimpdataeditor.c \
gimpdataeditor.h \
gimpdatafactoryview.c \
cleanup. 2001-04-22 Michael Natterer <mitch@gimp.org> * app/Makefile.am: cleanup. * app/interface.c: #include "gimpui.h" * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c * app/gui/menus.c * app/gui/test-commands.[ch]: changes for the image menu below. * app/apptypes.h * app/widgets/Makefile.am * app/widgets/gimpcontainermenu.[ch] * app/widgets/gimpcontainermenuimpl.[ch]: new widgets. The actual implemtation lives in a separate file because gimpcontainermenu.c's code is identical to gimpcontainerview.c's except for the base class. This will become an interface with Gtk 2.0. * app/widgets/gimpimagedock.[ch]: a dock with an image menu. The pages still don't follow the context correctly. * app/widgets/gimpmenuitem.[ch]: a menu item with a preview. * app/widgets/gimpdialogfactory.[ch]: pass a dock constructor to the constructor and provide a method to create a new dock within this factory's context. * app/widgets/gimpdock.[ch]: removed the constructor because we create only image docks now. Put the vbox into a main_vbox (which also contains the image menu). * app/widgets/gimpdockbook.[ch]: create new docks with the dialog factory. * app/gimpcontainer.[ch] * app/gimpdata.[ch] * app/gimpdatafactory.[ch] * app/gimpdatalist.[ch] * app/gimplist.[ch] * app/gimpviewable.[ch] * app/widgets/gimpbrushpreview.[ch] * app/widgets/gimpcontainergridview.[ch] * app/widgets/gimpcontainerlistview.[ch] * app/widgets/gimpcontainerview.[ch] * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpdockable.[ch] * app/widgets/gimpdrawablelistitem.[ch] * app/widgets/gimpdrawablelistview.[ch] * app/widgets/gimpdrawablepreview.[ch] * app/widgets/gimplayerlistitem.[ch] * app/widgets/gimplayerlistview.[ch] * app/widgets/gimplistitem.[ch] * app/widgets/gimppalettepreview.[ch] * app/widgets/gimppatternpreview.[ch] * app/widgets/gimppreview.[ch]: ass-sign some copyrights.
2001-04-22 00:38:56 +00:00
gimpdatafactoryview.h \
app/Makefile.am removed, chopped... 2001-12-07 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/devices.[ch]: removed, chopped... * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/gui/Makefile.am * app/widgets/gimpdeviceinfo.[ch] * app/widgets/gimpdevices.[ch] * app/gui/device-status-dialog.[ch] * app/gui/input-dialog.[ch]: ...and added here. Made GimpToolInfo a GimpContext subclass. Create a GimpDeviceManager struct in gimpdevices.c and attach it to the Gimp instance. * app/core/gimp.[ch]: removed gimp_create_context(). It was a bad idea in the first place beause it prevented GimpContext subclasses from being be properly registered with their Gimp instance. * app/core/gimpcontext.c: moved the stuff which used to be in gimp_create_context() back here. Added a "gimp" property which must be set on construction. Added a "dispose" implementation which removes the context from it's Gimp's context_list. * app/gimprc.c * app/core/gimptoolinfo.[ch] * app/display/gimpdisplayshell-callbacks.c * app/gui/brush-select.c * app/gui/dialogs-constructors.c * app/gui/gradient-editor.c * app/gui/gradient-select.c * app/gui/gui.c * app/gui/menus.c * app/gui/palette-editor.c * app/gui/palette-select.c * app/gui/pattern-select.c * app/gui/toolbox.c * app/tools/gimppainttool.c * app/tools/tool_manager.c * app/widgets/gimpimagedock.c: changed accordingly. * app/gui/tools-commands.[ch]: made all callback signatures the same. * app/gui/preferences-dialog.c: cleaned up the display_format_string GtkCombo code.
2001-12-07 17:39:51 +00:00
gimpdeviceinfo.c \
gimpdeviceinfo.h \
gimpdevices.c \
gimpdevices.h \
gimpdevicestatus.c \
gimpdevicestatus.h \
gimpdialogfactory.c \
gimpdialogfactory.h \
gimpdnd.c \
gimpdnd.h \
gimpdnd-xds.c \
gimpdnd-xds.h \
gimpdock.c \
gimpdock.h \
gimpdockable.c \
gimpdockable.h \
gimpdockbook.c \
gimpdockbook.h \
gimpdocked.c \
gimpdocked.h \
gimpdockseparator.c \
gimpdockseparator.h \
gimpdocumentview.c \
gimpdocumentview.h \
Added GtkTreeView versions of layers/channels/vectors: 2003-03-16 Michael Natterer <mitch@gimp.org> Added GtkTreeView versions of layers/channels/vectors: * app/core/core-enums.[ch]: renamed GIMP_UNDO_GROUP_LAYER_PROPERTIES to GIMP_UNDO_GROUP_ITEM_PROPERTIES. * app/core/gimpcontainer.c (gimp_container_reorder): don't try to reorder containers with num_children == 1. * app/core/gimpmarshal.list: added VOID: STRING, UINT marshaller. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpchanneltreeview.[ch] * app/widgets/gimpdrawabletreeview.[ch] * app/widgets/gimpitemtreeview.[ch] * app/widgets/gimplayertreeview.[ch] * app/widgets/gimpvectorstreeview.[ch]: new widgets. * app/widgets/gimpcellrenderertoggle.c: draw the frame only if the cell is prelit. * app/widgets/gimpcellrendererviewable.[ch]: added "clicked" signal, unref the renderer in finalize(). Set the renderer's border color to black if the cell is not selected (a hack that saves tons of code in GimpLayerTreeView). * app/widgets/gimpcomponenteditor.c: no need to gtk_list_store_set() stuff we just got from the store. * app/widgets/gimpcontainertreeview.[ch]: added lots of state used by the new subclasses to the GimpContainerTreeView struct. Create the GtkListStore/GtkTreeView in GObject::constructor() and only collect parameters in init() so subclasses can modify store/view creation. Do most of the button_press_event stuff manually and return TRUE from the handler. * app/widgets/gimpcontainerview.c: cleanup. * app/widgets/gimpitemlistview.h * app/widgets/gimpvectorslistview.h: temp hacks before they die. * app/widgets/gimppreviewrenderer.[ch]: added gimp_preview_renderer_update_idle() which idle-emits "update" without invalidating. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c: added constructors for the new dialogs. * app/gui/channels-commands.c * app/gui/channels-menu.c * app/gui/layers-commands.c * app/gui/layers-menu.c * app/gui/vectors-commands.c * app/gui/vectors-menu.c: accept tree views as callback data.
2003-03-16 11:14:29 +00:00
gimpdrawabletreeview.c \
gimpdrawabletreeview.h \
gimpeditor.c \
gimpeditor.h \
gimpenumaction.c \
gimpenumaction.h \
Cleaned up and improved the message system: 2003-06-13 Michael Natterer <mitch@gimp.org> Cleaned up and improved the message system: * app/core/gimp.[ch]: added "const gchar *domain" to GimpMessageFunc (a NULL domain means the message is from the GIMP core, everything else is a plug-in). * app/errors.c: pass "domain == NULL" to gimp_message(). * tools/pdbgen/pdb/message.pdb: derive the message domain from the current plug-in's menu_path (evil hack but works reasonably well). * app/pdb/message_cmds.c: regenerated. * app/widgets/gimpwidgets-utils.[ch] (gimp_message_box): added a header showing the message domain and changed the dialog layout to follow the HIG more closely. * app/gui/error-console-dialog.[ch]: removed. * app/widgets/gimperrorconsole.[ch] * app/gui/error-console-commands.[ch] * app/gui/error-console-menu.[ch]: new files containing a re-implementation of the error console dialog. * app/gui/Makefile.am * app/gui/dialogs-constructors.c * app/gui/gui.c * app/gui/menus.c * app/widgets/Makefile.am * app/widgets/widgets-types.h: changed accordingly. * app/display/gimpprogress.c: added more spacing and removed the separator (more HIG compliant). * plug-ins/[most plug-ins].c: Changed lots of messages and progress strings: - Removed plug-in names from messages since that's automatically covered by "domain" now. - Put all filenames in ''. - Changed "Loading" to "Opening". - Added "..." to all progress messages. - Cleaned up all file open/save error messages to look the same and include g_strerror(errno). - Removed special casing for progress bars and *always* show them, not only if run_mode != GIMP_RUN_NONINTERACTIVE (we can't expect all plug-ins to do this correctly but need to hack the core to sort out unwanted progress bars). Unrelated: - Cleaned up indentation, spacing, #includes, coding style and other stuff while I was at all these files.
2003-06-13 14:37:00 +00:00
gimperrorconsole.c \
gimperrorconsole.h \
gimperrordialog.c \
gimperrordialog.h \
gimpfgbgeditor.c \
gimpfgbgeditor.h \
gimpfgbgview.c \
gimpfgbgview.h \
gimpfiledialog.c \
gimpfiledialog.h \
gimpfileprocview.c \
gimpfileprocview.h \
gimpfontselect.c \
gimpfontselect.h \
gimpfontview.c \
gimpfontview.h \
gimpgradienteditor.c \
gimpgradienteditor.h \
gimpgradientselect.c \
gimpgradientselect.h \
removed the grid parasite related functions from here ... 2003-10-10 Henrik Brix Andersen <brix@gimp.org> * app/core/gimpimage-grid.[ch]: removed the grid parasite related functions from here ... * app/core/gimpgrid.[ch]: ... and added them here. While I was at it I also changed PROP_TYPE to PROP_STYLE and added blurbs to the properties * app/xcf/xcf-load.c * app/display/gimpdisplayshell.c: changed accordingly * app/widgets/Makefile.am * po/POTFILES.in * app/widgets/widgets-types.h * app/widgets/gimpgrideditor.[ch]: added a new GimpGridEditor widget - with a work-around for the fact that gimp_prop_coordinated_new() doesn't accept boundaries * app/gui/grid-dialog.h * app/gui/grid-dialog.c (grid_dialog_new): use the new GimpGridEditor widget, take a GimpImage as function parameter, assume GimpImages always have a GimpGrid. This simplifies the grid dialog. * app/gui/image-commands.c (image_configure_grid_cmd_callback): changed accordingly * app/core/core-types.h: moved typedef GimpGrid from here ... * app/config/config-types.h: ... to here to be able to use it in GimpCoreConfig * app/config/gimprc-blurbs.h * app/config/gimpcoreconfig.[ch]: added default_grid member * app/widgets/gimphelp-ids.h * themes/Default/images/preferences/Makefile.am * themes/Default/images/default-grid.png * app/gui/preferences-dialog.c: added UI for specifying default image grid * app/core/gimpimage.c (gimp_image_new): create a GimpGrid from core_config->default_grid * app/gui/image-menu.c (image_menu_update): the grid/guide entries in <Image>/View/ should always be sensitive ... * app/display/gimpdisplayshell.c (gimp_display_shell_init): ... but the grid entries should be disabled by default
2003-10-10 14:11:47 +00:00
gimpgrideditor.c \
gimpgrideditor.h \
app/Makefile.am removed... 2002-05-05 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch]: removed... * app/widgets/Makefile.am * app/widgets/gimphelp.[ch]: ...and added here. * app/widgets/widgets-enums.[ch]: added GimpHelpBrowserType here as registered enum. Added an evil hack with GimpCursorType so app/config/gimpguiconfig.h can include this file. * app/widgets/gimpcursor.c: added an assertion because of the changed GimpCursorType. * app/config/gimpguiconfig.[ch]: added a property for the help browser type. * app/gimprc.c * app/libgimp_glue.c * app/gui/preferences-dialog.c * tools/pdbgen/pdb/help.pdb * app/pdb/help_cmds.c: regenerated. Some nav_window cleanup before chopping: * app/nav_window.[ch]: removed the old preview code and use GimpNavigationPreviews only. Namespaceified all functions. Speak in terms of GimpDisplayShell, not GimpDisplay. Lots of internal cleanup. * app/gui/gui-types.h: removed NadiagtionDialog here... * app/display/display-types.h: ...and added it here. * app/display/gimpdisplayshell-callbacks.[ch]: added a callback for the navigation button and call nav_window_show_popup() from there. * app/display/gimpdisplayshell.c: free shell->nav_dialog unconditionally, connect to the new callback. * app/display/gimpdisplayshell-scale.c * app/display/gimpdisplayshell-scroll.c * app/gui/view-commands.c: changed accordingly. * app/widgets/gimppreview.c (gimp_preview_set_viewable): the assertion introduced recently was too tight, breaking GimpNavigationPreview. Changed it to do an "is a" check, not exact preview type matching. * app/widgets/gimpimagepreview.c: added quick-hack support for xres != yres. * app/widgets/gimpnavigationpreview.[ch]: made gimp_navigation_preview_grab_pointer() public so the nav_window can call it. Unrelated: * app/display/gimpdisplay.c: removed the gui/ dependency from this file by removing info_window stuff. * app/display/gimpdisplayshell.c (gimp_display_shell_flush): update the info_window here. * app/gui/dialogs-constructors.c (dialogs_indexed_palette_new): call gimp_dockable_set_context() like all other constructors. * app/undo.c * app/paint/gimppaintcore.h: some more include cleanup.
2002-05-05 19:17:41 +00:00
gimphelp.c \
gimphelp.h \
app/widgets/Makefile.am new file defining the available help topics. Work 2003-08-21 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/gimphelp-ids.h: new file defining the available help topics. Work in progress and totally unusable for matching to the help system. Stay tuned... * app/gui/about-dialog.c * app/gui/brushes-menu.c * app/gui/buffers-menu.c * app/gui/channels-commands.[ch] * app/gui/channels-menu.c * app/gui/edit-commands.c * app/gui/file-commands.c * app/gui/file-new-dialog.c * app/gui/file-open-dialog.c * app/gui/file-save-dialog.c * app/gui/gradients-commands.c * app/gui/gradients-menu.c * app/gui/image-menu.c * app/gui/layers-commands.[ch] * app/gui/layers-menu.c * app/gui/module-browser.c * app/gui/offset-dialog.c * app/gui/palettes-menu.c * app/gui/patterns-menu.c * app/gui/resize-dialog.c * app/gui/select-commands.c * app/gui/templates-menu.c * app/gui/tips-dialog.c * app/gui/toolbox-menu.c * app/gui/vectors-commands.[ch] * app/gui/vectors-menu.c: replaced literal HTML file paths by help IDs from gimphelp-ids.h. Renamed some menu callbacks to be consistent with similar ones. This is just an intermediate commit and not finished. While browsing all the menus, I noticed that our "x to selection" functions are not consistent at all. They should all offer the REPLACE,ADD,SUBTRACT,INTERSECT options: * app/core/gimpchannel.[ch]: added new function gimp_channel_new_from_alpha(). Removed gimp_channel_layer_alpha() and gimp_channel_layer_mask(). * app/core/gimpimage-mask.[ch]: added gimp_image_mask_select_alpha() and gimp_image_mask_select_component() which offer the full set of operation, feather and feather_radius parameters as the other selection functions. * app/core/gimpimage-mask-select.[ch]: removed gimp_image_mask_layer_alpha() and gimp_image_mask_layer_mask(). * app/gui/channels-commands.c (channels_channel_to_selection): use gimp_image_mask_select_component() instead of implementing it here. * app/gui/image-menu.c * app/gui/layers-commands.[ch]: offer the full choice of REPLACE,ADD,SUBTRACT,INTERSECT with "Alpha to Selection" and "Mask to Selection". * tools/pdbgen/pdb/selection.pdb: changed accordingly. * app/pdb/selection_cmds.c: regenerated.
2003-08-21 15:54:47 +00:00
gimphelp-ids.h \
gimphistogrambox.c \
gimphistogrambox.h \
gimphistogrameditor.c \
gimphistogrameditor.h \
gimphistogramview.c \
gimphistogramview.h \
cleanup. 2001-04-22 Michael Natterer <mitch@gimp.org> * app/Makefile.am: cleanup. * app/interface.c: #include "gimpui.h" * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c * app/gui/menus.c * app/gui/test-commands.[ch]: changes for the image menu below. * app/apptypes.h * app/widgets/Makefile.am * app/widgets/gimpcontainermenu.[ch] * app/widgets/gimpcontainermenuimpl.[ch]: new widgets. The actual implemtation lives in a separate file because gimpcontainermenu.c's code is identical to gimpcontainerview.c's except for the base class. This will become an interface with Gtk 2.0. * app/widgets/gimpimagedock.[ch]: a dock with an image menu. The pages still don't follow the context correctly. * app/widgets/gimpmenuitem.[ch]: a menu item with a preview. * app/widgets/gimpdialogfactory.[ch]: pass a dock constructor to the constructor and provide a method to create a new dock within this factory's context. * app/widgets/gimpdock.[ch]: removed the constructor because we create only image docks now. Put the vbox into a main_vbox (which also contains the image menu). * app/widgets/gimpdockbook.[ch]: create new docks with the dialog factory. * app/gimpcontainer.[ch] * app/gimpdata.[ch] * app/gimpdatafactory.[ch] * app/gimpdatalist.[ch] * app/gimplist.[ch] * app/gimpviewable.[ch] * app/widgets/gimpbrushpreview.[ch] * app/widgets/gimpcontainergridview.[ch] * app/widgets/gimpcontainerlistview.[ch] * app/widgets/gimpcontainerview.[ch] * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpdockable.[ch] * app/widgets/gimpdrawablelistitem.[ch] * app/widgets/gimpdrawablelistview.[ch] * app/widgets/gimpdrawablepreview.[ch] * app/widgets/gimplayerlistitem.[ch] * app/widgets/gimplayerlistview.[ch] * app/widgets/gimplistitem.[ch] * app/widgets/gimppalettepreview.[ch] * app/widgets/gimppatternpreview.[ch] * app/widgets/gimppreview.[ch]: ass-sign some copyrights.
2001-04-22 00:38:56 +00:00
gimpimagedock.c \
gimpimagedock.h \
gimpimageeditor.c \
gimpimageeditor.h \
gimpimagepropview.c \
gimpimagepropview.h \
gimpimageview.c \
gimpimageview.h \
Added GtkTreeView versions of layers/channels/vectors: 2003-03-16 Michael Natterer <mitch@gimp.org> Added GtkTreeView versions of layers/channels/vectors: * app/core/core-enums.[ch]: renamed GIMP_UNDO_GROUP_LAYER_PROPERTIES to GIMP_UNDO_GROUP_ITEM_PROPERTIES. * app/core/gimpcontainer.c (gimp_container_reorder): don't try to reorder containers with num_children == 1. * app/core/gimpmarshal.list: added VOID: STRING, UINT marshaller. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpchanneltreeview.[ch] * app/widgets/gimpdrawabletreeview.[ch] * app/widgets/gimpitemtreeview.[ch] * app/widgets/gimplayertreeview.[ch] * app/widgets/gimpvectorstreeview.[ch]: new widgets. * app/widgets/gimpcellrenderertoggle.c: draw the frame only if the cell is prelit. * app/widgets/gimpcellrendererviewable.[ch]: added "clicked" signal, unref the renderer in finalize(). Set the renderer's border color to black if the cell is not selected (a hack that saves tons of code in GimpLayerTreeView). * app/widgets/gimpcomponenteditor.c: no need to gtk_list_store_set() stuff we just got from the store. * app/widgets/gimpcontainertreeview.[ch]: added lots of state used by the new subclasses to the GimpContainerTreeView struct. Create the GtkListStore/GtkTreeView in GObject::constructor() and only collect parameters in init() so subclasses can modify store/view creation. Do most of the button_press_event stuff manually and return TRUE from the handler. * app/widgets/gimpcontainerview.c: cleanup. * app/widgets/gimpitemlistview.h * app/widgets/gimpvectorslistview.h: temp hacks before they die. * app/widgets/gimppreviewrenderer.[ch]: added gimp_preview_renderer_update_idle() which idle-emits "update" without invalidating. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c: added constructors for the new dialogs. * app/gui/channels-commands.c * app/gui/channels-menu.c * app/gui/layers-commands.c * app/gui/layers-menu.c * app/gui/vectors-commands.c * app/gui/vectors-menu.c: accept tree views as callback data.
2003-03-16 11:14:29 +00:00
gimpitemtreeview.c \
gimpitemtreeview.h \
gimplayertreeview.c \
gimplayertreeview.h \
gimpmenudock.c \
gimpmenudock.h \
Move away from creating all item_factories statically in menus_init() but 2003-01-10 Michael Natterer <mitch@gimp.org> Move away from creating all item_factories statically in menus_init() but create a new one for each place where one is needed: * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpmenufactory.[ch]: new factory which creates and configures the GimpItemFactories it knows about on-the-fly. * app/widgets/gimpitemfactory.[ch]: added gimp_item_factory_update() which calls the "update_func". Added "gboolean update_on_popup" so item_factories can be configured to require manual updates (used for the <Image> factory). * app/gui/menus.[ch]: create a "global_menu_factory" and register all menus we have with it. Added various setup functions which do stuff like adding the "Open Recent" menu or reorder plug-in menu entries. Removed the debugging stuff... * app/gui/Makefile.am * app/gui/debug-commands.[ch]: ...and added it here. * app/gui/gui.c: create the <Toolbox>, the popup-<Image> and the <Paths> factories here because they are still global. * app/gui/plug-in-menus.[ch]: changed the "image_factory" parameters to "item_factory" and create/update the entries for the passed item_factory only. Makes the whole stuff much more straightforward. * app/plug-in/plug-ins.c: don't call plug_in_make_menu(). * app/display/gimpdisplay.[ch] * app/display/gimpdisplayshell.[ch]: added "menu_factory" and "popup_factory" parameters to gimp_display_new() and gimp_display_shell_new(). Create the menubar_factory and the qmask_factory dynamically. Pass the shell, not a Gimp to the QMask callbacks. Changed gimp_display_shell_set_menu_sensitivity() to gimp_display_shell_menu_update() and don't call it directly (it's a GimpItemFactory update_func now). Call gimp_item_factory_update() on the resp. factories instead. * app/gui/qmask-commands.c * app/display/gimpdisplayshell-callbacks.c * app/tools/gimpimagemaptool.c: changed accordingly. * app/widgets/gimpbrusheditor.c * app/widgets/gimpbrushfactoryview.[ch] * app/widgets/gimpbufferview.[ch] * app/widgets/gimpcolormapeditor.[ch] * app/widgets/gimpcontainereditor.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpdialogfactory.[ch] * app/widgets/gimpdock.c * app/widgets/gimpdockbook.[ch] * app/widgets/gimpdocumentview.[ch] * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpimageview.[ch] * app/widgets/gimpitemlistview.[ch] * app/widgets/gimppaletteeditor.[ch]: pass around lots of GimpMenuFactory pointers and menu_identifiers so all views can create their item_factories themselves. Unref the factories when they are no longer needed because they belong to the views now. * app/gui/dialogs-commands.c * app/gui/dialogs-constructors.c * app/gui/dialogs.c * app/gui/brush-select.c * app/gui/gradient-select.c * app/gui/palette-select.c * app/gui/pattern-select.c: changed accordingly. * app/gui/file-dialog-utils.[ch] (file_dialog_new): require menu_factory and menu_identifier parameters. * app/gui/file-open-dialog.[ch] * app/gui/file-save-dialog.[ch]: removed file_*_dialog_menu_init() (they went to menus.c as setup_funcs). Added file_*_dialog_set_type() and moved the <Load> and <Save> factory callbacks to file-commands.c * app/gui/file-commands.[ch]: changed accordingly. * app/gui/view-commands.c: changed the statusbar, menubar, rulers and guides callbacks to do their job only if the setting has actually changed. Don't update whole item factories afterwards. Instead, just change the state of the items that actually need update. Unrelated: * app/core/gimpchannel.c (gimp_channel_init): set "bounds_known" and friends to FALSE since we don't know that the new channel will be empty (fixes QMask and probably other stuff). * app/gui/image-commands.c * app/gui/vectors-commands.c: cleanup.
2003-01-10 17:55:53 +00:00
gimpmenufactory.c \
gimpmenufactory.h \
gimpmessagebox.c \
gimpmessagebox.h \
gimpmessagedialog.c \
gimpmessagedialog.h \
gimpnavigationview.c \
gimpnavigationview.h \
gimppaletteeditor.c \
gimppaletteeditor.h \
gimppaletteselect.c \
gimppaletteselect.h \
gimppaletteview.c \
gimppaletteview.h \
gimppatternfactoryview.c \
gimppatternfactoryview.h \
gimppatternselect.c \
gimppatternselect.h \
gimppdbdialog.c \
gimppdbdialog.h \
Implement dragging and dropping in any GdkPixbuf supported format. Fixes 2005-04-09 Michael Natterer <mitch@gimp.org> Implement dragging and dropping in any GdkPixbuf supported format. Fixes bug #172794 and bug #172795. * app/core/gimplayer.[ch] (gimp_layer_new_from_region): new function which contains all stuff that was in gimp_layer_new_from_tiles(). (gimp_layer_new_from_tiles): use above function. (gimp_layer_new_from_pixbuf): new function. * app/widgets/Makefile.am * app/widgets/gimppixbuf.[ch]: new files containing GdkPixbuf utility functions for clipboard and DnD. * app/widgets/gimpselectiondata.[ch]: removed gimp_selection_data_set,get_pixbuf(), GTK+ provides the same API. Also removed GdkAtom parameters all over the place because it's always the same as selection_data->target. * app/widgets/gimpclipboard.c: use the new pixbuf utility functions and gtk_selection_data_set,get_pixbuf(). * app/widgets/widgets-enums.h * app/widgets/gimpdnd.[ch]: removed never-implemented GIMP_DND_TYPE_PNG and added a generic GIMP_DND_TYPE_PIXBUF instead. Added API to drag and drop GdkPixbufs which transparently converts from/to and GdkPixbuf-supported image format. Removed passing around of GdkAtoms, since they were always the same as selection_data->target. * app/widgets/gimpdnd-xds.[ch]: follow GdkAtom parameter removal. * app/widgets/gimpcontainertreeview.[ch]: added virtual function GimpContainerTreeView::drop_pixbuf(). * app/widgets/gimpcontainertreeview-dnd.c: dispatch drop_pixbuf(). * app/widgets/gimplayertreeview.c: implement drop_pixbuf(). * app/widgets/gimpdrawabletreeview.c: allow to drag all drawables as pixbufs. * app/display/gimpdisplayshell-dnd.c: allow dropping of pixbufs.
2005-04-09 17:56:04 +00:00
gimppixbuf.c \
gimppixbuf.h \
gimppluginaction.c \
gimppluginaction.h \
gimpprogressbox.c \
gimpprogressbox.h \
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
gimpprogressdialog.c \
gimpprogressdialog.h \
gimppropwidgets.c \
gimppropwidgets.h \
gimprender.c \
gimprender.h \
added new signals "sample-point-added" and "sample-point-removed" and 2005-04-03 Michael Natterer <mitch@gimp.org> * app/core/gimpimage.[ch]: added new signals "sample-point-added" and "sample-point-removed" and public functions to emit them. * app/core/gimpimage-sample-points.c (gimp_image_add_sample_point) (gimp_image_remove_sample_point): emit them accordingly. * app/core/gimpimage-undo-push.c (undo_pop_image_sample_point): ditto. (undo_pop_image_guide) (undo_pop_image_sample_point): added comments why we add/remove stuff manually instead of using the GimpImage APIs. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpcursorview.[ch] * app/widgets/gimpsamplepointeditor.[ch]: new widgets. GimpCursorView is a replacement for the info window's "Cursor" page, GimpSamplePointEditor is a view on an image's sample points. The sample point editor does nothing yet except keeping a 2x2 grid of GimpColorFrames. Addresses bug #137776. * app/dialogs/dialogs.c * app/dialogs/dialogs-constructors.[ch]: register the new widgets as dockable dialogs. * app/actions/dialogs-actions.c (dialogs_dockable_actions) * menus/dialogs-menuitems.xml: added actions and menu items for the new dialogs. * app/display/gimpdisplayshell-cursor.c (gimp_display_shell_update_cursor) (gimp_display_shell_clear_cursor): update the new cursor view. * app/widgets/gimphelp-ids.h: help IDs for the new dialogs. * app/widgets/widgets-enums.[ch] (enum GimpColorFrameMode): changed description "Pixel values" to "Pixel" because the former was too long.
2005-04-03 15:48:03 +00:00
gimpsamplepointeditor.c \
gimpsamplepointeditor.h \
gimpselectiondata.c \
gimpselectiondata.h \
gimpselectioneditor.c \
gimpselectioneditor.h \
gimpsessioninfo.c \
gimpsessioninfo.h \
gimpsizebox.c \
gimpsizebox.h \
gimpstringaction.c \
gimpstringaction.h \
gimpstrokeeditor.c \
gimpstrokeeditor.h \
gimptemplateeditor.c \
gimptemplateeditor.h \
gimptemplateview.c \
gimptemplateview.h \
gimptexteditor.c \
gimptexteditor.h \
gimpthumbbox.c \
gimpthumbbox.h \
g_strdup() the stock_id passed to gimp_tool_info_new() because the 2002-03-14 Michael Natterer <mitch@gimp.org> * app/core/gimptoolinfo.c: g_strdup() the stock_id passed to gimp_tool_info_new() because the caller's memory may disappear after registering the tool (tool modules). Made a GimpDock out of the toolbox: * app/gui/Makefile.am * app/gui/color-area.[ch] * app/gui/indicator-area.[ch] * app/gui/toolbox.[ch]: removed... * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimptoolbox-color-area.[ch] * app/widgets/gimptoolbox-indicator-area.[ch] * app/widgets/gimptoolbox.[ch]: ...and added here. * app/widgets/gimpdock.[ch]: don't set a minimal width. Added a "destroy_if_empty" boolean so we can prevent destruction of the toolbox if it's last dockable is removed. Added gimp_dock_construct() which is called from GimpImageDock and GimpToolbox. * app/widgets/gimpimagedock.[ch]: Default to not showing the image menu, set a minimal width here, misc. minor cleanup. * app/widgets/gimpdockbook.c: some more GIMP_IS_IMAGE_DOCK() checks, fixed dnd widget creation. * app/widgets/gimpdialogfactory.[ch]: changed gimp_dialog_factories_toggle() to take just the toolbox_factory as parameter. When restoring the session use the created dock's dialog factory to create dockables, not the the factory we created the dock from (for the toolbox). * app/display/gimpdisplayshell-callbacks.c: changed accordingly. * app/gui/dialogs.[ch]: create an own dialog factory for the toolbox and set dialogs_toolbox_new() as it's new_dock_func. * app/gui/dialogs-constructors.[ch]: changed dialogs_toolbox_get() accordingly. * app/gui/dialogs-commands.[ch]: added dialogs_show_toolbox(), ckeck if a dock is really a GimpImageDock before casting. * app/gui/gui.c * app/gui/menus.c * app/widgets/gimppaletteeditor.c: changed accordingly. * app/gui/color-notebook.c * app/gui/color-select.c * app/gui/colormap-dialog.c * app/gui/palette-editor-commands.c: removed useless inclusion of "gui/color-area.h". * themes/Default/gtkrc: set "gimp-dock-style" for GimpToolbox widgets.
2002-03-14 17:07:02 +00:00
gimptoolbox.c \
gimptoolbox.h \
gimptoolbox-color-area.c \
gimptoolbox-color-area.h \
gimptoolbox-dnd.c \
gimptoolbox-dnd.h \
gimptoolbox-image-area.c \
gimptoolbox-image-area.h \
g_strdup() the stock_id passed to gimp_tool_info_new() because the 2002-03-14 Michael Natterer <mitch@gimp.org> * app/core/gimptoolinfo.c: g_strdup() the stock_id passed to gimp_tool_info_new() because the caller's memory may disappear after registering the tool (tool modules). Made a GimpDock out of the toolbox: * app/gui/Makefile.am * app/gui/color-area.[ch] * app/gui/indicator-area.[ch] * app/gui/toolbox.[ch]: removed... * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimptoolbox-color-area.[ch] * app/widgets/gimptoolbox-indicator-area.[ch] * app/widgets/gimptoolbox.[ch]: ...and added here. * app/widgets/gimpdock.[ch]: don't set a minimal width. Added a "destroy_if_empty" boolean so we can prevent destruction of the toolbox if it's last dockable is removed. Added gimp_dock_construct() which is called from GimpImageDock and GimpToolbox. * app/widgets/gimpimagedock.[ch]: Default to not showing the image menu, set a minimal width here, misc. minor cleanup. * app/widgets/gimpdockbook.c: some more GIMP_IS_IMAGE_DOCK() checks, fixed dnd widget creation. * app/widgets/gimpdialogfactory.[ch]: changed gimp_dialog_factories_toggle() to take just the toolbox_factory as parameter. When restoring the session use the created dock's dialog factory to create dockables, not the the factory we created the dock from (for the toolbox). * app/display/gimpdisplayshell-callbacks.c: changed accordingly. * app/gui/dialogs.[ch]: create an own dialog factory for the toolbox and set dialogs_toolbox_new() as it's new_dock_func. * app/gui/dialogs-constructors.[ch]: changed dialogs_toolbox_get() accordingly. * app/gui/dialogs-commands.[ch]: added dialogs_show_toolbox(), ckeck if a dock is really a GimpImageDock before casting. * app/gui/gui.c * app/gui/menus.c * app/widgets/gimppaletteeditor.c: changed accordingly. * app/gui/color-notebook.c * app/gui/color-select.c * app/gui/colormap-dialog.c * app/gui/palette-editor-commands.c: removed useless inclusion of "gui/color-area.h". * themes/Default/gtkrc: set "gimp-dock-style" for GimpToolbox widgets.
2002-03-14 17:07:02 +00:00
gimptoolbox-indicator-area.c \
gimptoolbox-indicator-area.h \
gimptooldialog.c \
gimptooldialog.h \
gimptooloptionseditor.c \
gimptooloptionseditor.h \
gimptoolview.c \
gimptoolview.h \
app/widgets/Makefile.am app/widgets/widgets-types.h new GtkUIManager 2004-04-21 Michael Natterer <mitch@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpuimanager.[ch]: new GtkUIManager subclass. Adds API to update all action groups and knows which UIs it can create from which XML files. * app/widgets/gimpmenufactory.[ch]: register the XML file basenames along with path of their toplevel menus. Create GimpUIManagers instead of GtkUIManagers and register the XML files and menu paths with them. * app/gui/menus.c: register all XML files and their toplevel menu paths. * app/widgets/gimpeditor.[ch]: also create a GimpUIManager when creating the GtkItemFactory. Added "const gchar *ui_identifier" parameter to gimp_editor_create_menu(). * app/widgets/gimpcontainereditor.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpitemtreeview.[ch]: added "ui_identifier" parameters to all constructors. * app/widgets/gimpbrusheditor.c * app/widgets/gimpbrushfactoryview.c * app/widgets/gimpbufferview.c * app/widgets/gimpcolormapeditor.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerpopup.c * app/widgets/gimpdocumentview.c * app/widgets/gimperrorconsole.c * app/widgets/gimpfontview.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpimageview.c * app/widgets/gimppaletteeditor.c * app/widgets/gimppatternfactoryview.c * app/widgets/gimptemplateview.c * app/widgets/gimptooloptionseditor.c * app/gui/dialogs-constructors.c * app/gui/gradient-select.c * app/gui/palette-select.c * app/gui/pattern-select.c: pass UI identifiers to the changed functions above. * app/display/gimpdisplayshell.[ch]: added a GimpUIManager for the menubar (menubar creating code still commented out). * app/display/gimpdisplay.c * app/gui/gui-vtable.c: update the ui manager.
2004-04-21 16:33:17 +00:00
gimpuimanager.c \
gimpuimanager.h \
Reimplemented the undo history: 2003-02-20 Michael Natterer <mitch@gimp.org> Reimplemented the undo history: * app/Makefile.am * app/undo_history.[ch]: removed. Changes/cleanups to the undo system to enable/simplify the new undo history implementation: * app/core/core-types.h: removed enum undo_event_t. Removed the GimpImage parameter from GimpUndoPopFunc and GimpUndoFreeFunc because GimpUndo has a GimpImage pointer now (see below). * app/core/core-enums.[ch]: added enum GimpUndoEvent. Added an enum value for REDO_EXPIRED. * app/core/gimpimage.[ch]: added a GimpUndo pointer to the "undo_event" signal which needs to be passed for all events except UNDO_FREE. * app/display/gimpdisplayshell-handlers.c: changed accordingly. * app/core/gimpundo.[ch]: added a GimpImage pointer to the GimpUndo struct. Removed GimpImage parameters all over the place. Added preview stuff. The preview creation needs to be triggered explicitly using gimp_undo_create_preview() because the GimpUndo can't know when it's possible to create the preview. * app/core/gimpimage-undo-push.c * app/paint/gimppaintcore-undo.c * app/tools/gimptransformtool-undo.c: changed accordingly, cleanup. * app/core/gimpundostack.[ch]: ditto. Return the freed undo from gimp_undo_stack_free_bottom(). Removed unused container signal handlers. * app/core/gimpimage-undo.c: free the redo stack the same way old undos are freed (from bottom up). Emit "undo_event" with event == REDO_EXPIRED for each removed redo. * app/core/gimpmarshal.list: added new marshallers. New undo history implementation: * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpundoeditor.[ch] * app/widgets/gimpundopreview.[ch]: new widgets for the undo step previews and the history itself. * app/widgets/gimppreview-utils.c: added GimpUndoPreview to the list of possible preview types. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs-menu.c * app/gui/dialogs.c * app/gui/image-menu.c * app/gui/toolbox-menu.c: removed the old and added the new undo history to the dialog factory and the various dialog menus. * app/widgets/gimpdnd.[ch]: don't warn if a GType has no corresponding DND type. Instead, return FALSE from the function that failed. * app/widgets/gimppreview.c: check the return value of gimpdnd functions. Not only add drag sources but also remove them when no longer needed. * app/widgets/gimpselectioneditor.h: removed unneeded inclusion of "gui/gui-types.h".
2003-02-20 12:47:42 +00:00
gimpundoeditor.c \
gimpundoeditor.h \
gimpunitcombobox.c \
gimpunitcombobox.h \
gimpunitstore.c \
gimpunitstore.h \
Added GtkTreeView versions of layers/channels/vectors: 2003-03-16 Michael Natterer <mitch@gimp.org> Added GtkTreeView versions of layers/channels/vectors: * app/core/core-enums.[ch]: renamed GIMP_UNDO_GROUP_LAYER_PROPERTIES to GIMP_UNDO_GROUP_ITEM_PROPERTIES. * app/core/gimpcontainer.c (gimp_container_reorder): don't try to reorder containers with num_children == 1. * app/core/gimpmarshal.list: added VOID: STRING, UINT marshaller. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpchanneltreeview.[ch] * app/widgets/gimpdrawabletreeview.[ch] * app/widgets/gimpitemtreeview.[ch] * app/widgets/gimplayertreeview.[ch] * app/widgets/gimpvectorstreeview.[ch]: new widgets. * app/widgets/gimpcellrenderertoggle.c: draw the frame only if the cell is prelit. * app/widgets/gimpcellrendererviewable.[ch]: added "clicked" signal, unref the renderer in finalize(). Set the renderer's border color to black if the cell is not selected (a hack that saves tons of code in GimpLayerTreeView). * app/widgets/gimpcomponenteditor.c: no need to gtk_list_store_set() stuff we just got from the store. * app/widgets/gimpcontainertreeview.[ch]: added lots of state used by the new subclasses to the GimpContainerTreeView struct. Create the GtkListStore/GtkTreeView in GObject::constructor() and only collect parameters in init() so subclasses can modify store/view creation. Do most of the button_press_event stuff manually and return TRUE from the handler. * app/widgets/gimpcontainerview.c: cleanup. * app/widgets/gimpitemlistview.h * app/widgets/gimpvectorslistview.h: temp hacks before they die. * app/widgets/gimppreviewrenderer.[ch]: added gimp_preview_renderer_update_idle() which idle-emits "update" without invalidating. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c: added constructors for the new dialogs. * app/gui/channels-commands.c * app/gui/channels-menu.c * app/gui/layers-commands.c * app/gui/layers-menu.c * app/gui/vectors-commands.c * app/gui/vectors-menu.c: accept tree views as callback data.
2003-03-16 11:14:29 +00:00
gimpvectorstreeview.c \
gimpvectorstreeview.h \
gimpview.c \
gimpview.h \
app/widgets/gimppreview-popup.c renamed these files... * app/widgets/gimppreview-popup.c * app/widgets/gimppreview-popup.h: renamed these files... * app/widgets/gimpview-popup.c * app/widgets/gimpview-popup.h: .. to these files, and changed the GimpPreviewPopup type to GimpViewPopup. * app/widgets/gimppreviewrenderer.c * app/widgets/gimppreviewrenderer.h: renamed these files... * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: .. to these files, and changed GimpPreviewRenderer to GimpViewRenderer. This is the second step of the great Preview->View renaming process. * app/display/gimpdisplayshell-layer-select.c * app/display/gimpnavigationeditor.c * app/widgets/Makefile.am * app/widgets/gimpbrushfactoryview.c * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpcellrendererviewable.h * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainerpopup.c * app/widgets/gimpcontainertreeview-dnd.c * app/widgets/gimpcontainertreeview.c * app/widgets/gimpcontainerview.c * app/widgets/gimpdatafactoryview.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimpnavigationpreview.c * app/widgets/gimppatternfactoryview.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimpselectioneditor.c * app/widgets/gimptemplateview.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimptoolview.c * app/widgets/gimpview.c * app/widgets/gimpview.h * app/widgets/gimpviewablebutton.c * app/widgets/widgets-enums.h * app/widgets/widgets-types.h: Modified accordingly.
2004-08-25 22:31:44 +00:00
gimpview-popup.c \
gimpview-popup.h \
gimpviewablebox.c \
gimpviewablebox.h \
gimpviewablebutton.c \
gimpviewablebutton.h \
gimpviewabledialog.c \
gimpviewabledialog.h \
app/widgets/gimppreview-popup.c renamed these files... * app/widgets/gimppreview-popup.c * app/widgets/gimppreview-popup.h: renamed these files... * app/widgets/gimpview-popup.c * app/widgets/gimpview-popup.h: .. to these files, and changed the GimpPreviewPopup type to GimpViewPopup. * app/widgets/gimppreviewrenderer.c * app/widgets/gimppreviewrenderer.h: renamed these files... * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: .. to these files, and changed GimpPreviewRenderer to GimpViewRenderer. This is the second step of the great Preview->View renaming process. * app/display/gimpdisplayshell-layer-select.c * app/display/gimpnavigationeditor.c * app/widgets/Makefile.am * app/widgets/gimpbrushfactoryview.c * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpcellrendererviewable.h * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainerpopup.c * app/widgets/gimpcontainertreeview-dnd.c * app/widgets/gimpcontainertreeview.c * app/widgets/gimpcontainerview.c * app/widgets/gimpdatafactoryview.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimpnavigationpreview.c * app/widgets/gimppatternfactoryview.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimpselectioneditor.c * app/widgets/gimptemplateview.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimptoolview.c * app/widgets/gimpview.c * app/widgets/gimpview.h * app/widgets/gimpviewablebutton.c * app/widgets/widgets-enums.h * app/widgets/widgets-types.h: Modified accordingly.
2004-08-25 22:31:44 +00:00
gimpviewrenderer.c \
gimpviewrenderer.h \
gimpviewrenderer-frame.c \
gimpviewrenderer-frame.h \
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
gimpviewrenderer-utils.c \
gimpviewrenderer-utils.h \
gimpviewrendererbrush.c \
gimpviewrendererbrush.h \
gimpviewrendererbuffer.c \
gimpviewrendererbuffer.h \
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
gimpviewrendererdrawable.c \
gimpviewrendererdrawable.h \
gimpviewrenderergradient.c \
gimpviewrenderergradient.h \
gimpviewrendererimage.c \
gimpviewrendererimage.h \
gimpviewrendererimagefile.c \
gimpviewrendererimagefile.h \
gimpviewrendererlayer.c \
gimpviewrendererlayer.h \
gimpviewrendererpalette.c \
gimpviewrendererpalette.h \
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
gimpviewrenderervectors.c \
gimpviewrenderervectors.h \
gimpwidgets-constructors.c \
gimpwidgets-constructors.h \
gimpwidgets-utils.c \
gimpwidgets-utils.h \
gtkwrapbox.c \
gtkwrapbox.h \
gtkhwrapbox.c \
gtkhwrapbox.h \
gtkvwrapbox.c \
gtkvwrapbox.h
libappwidgets_a_built_sources = widgets-enums.c
libappwidgets_a_SOURCES = \
$(libappwidgets_a_built_sources) $(libappwidgets_a_sources)
EXTRA_DIST = makefile.msc
#
# rules to generate built sources
#
# setup autogeneration dependencies
gen_sources = xgen-wec
CLEANFILES = $(gen_sources)
$(srcdir)/widgets-enums.c: $(srcdir)/widgets-enums.h $(GIMP_MKENUMS)
$(GIMP_MKENUMS) \
--fhead "#include \"config.h\"\n#include <gtk/gtk.h>\n#include \"libgimpbase/gimpbase.h\"\n#include \"widgets-enums.h\"\n#include \"gimp-intl.h\"" \
--fprod "\n/* enumerations from \"@filename@\" */" \
--vhead "GType\n@enum_name@_get_type (void)\n{\n static const G@Type@Value values[] =\n {" \
--vprod " { @VALUENAME@, \"@VALUENAME@\", \"@valuenick@\" }," \
--vtail " { 0, NULL, NULL }\n };\n" \
--dhead " static const Gimp@Type@Desc descs[] =\n {" \
--dprod " { @VALUENAME@, @valuedesc@, @valuehelp@ }," \
--dtail " { 0, NULL, NULL }\n };\n\n static GType type = 0;\n\n if (! type)\n {\n type = g_@type@_register_static (\"@EnumName@\", values);\n gimp_@type@_set_value_descriptions (type, descs);\n }\n\n return type;\n}\n" \
$(srcdir)/widgets-enums.h > xgen-wec \
&& cp xgen-wec $(@F) \
&& rm -f xgen-wec