2004-02-27 14:20:19 +00:00
|
|
|
/* The GIMP -- an image manipulation program
|
|
|
|
* Copyright (C) 1995 Spencer Kimball and Peter Mattis
|
|
|
|
*
|
|
|
|
* gimpfiledialog.c
|
|
|
|
* Copyright (C) 2004 Michael Natterer <mitch@gimp.org>
|
|
|
|
*
|
|
|
|
* This program is free software; you can redistribute it and/or modify
|
|
|
|
* it under the terms of the GNU General Public License as published by
|
|
|
|
* the Free Software Foundation; either version 2 of the License, or
|
|
|
|
* (at your option) any later version.
|
|
|
|
*
|
|
|
|
* This program is distributed in the hope that it will be useful,
|
|
|
|
* but WITHOUT ANY WARRANTY; without even the implied warranty of
|
|
|
|
* MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
|
|
|
|
* GNU General Public License for more details.
|
|
|
|
*
|
|
|
|
* You should have received a copy of the GNU General Public License
|
|
|
|
* along with this program; if not, write to the Free Software
|
|
|
|
* Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.
|
|
|
|
*/
|
|
|
|
|
|
|
|
#include "config.h"
|
|
|
|
|
|
|
|
#include <string.h>
|
|
|
|
|
|
|
|
#include <gtk/gtk.h>
|
|
|
|
|
|
|
|
#include "libgimpwidgets/gimpwidgets.h"
|
|
|
|
|
|
|
|
#include "widgets-types.h"
|
|
|
|
|
|
|
|
#include "core/gimp.h"
|
|
|
|
#include "core/gimpimage.h"
|
2004-08-10 18:47:21 +00:00
|
|
|
#include "core/gimpprogress.h"
|
2004-02-27 14:20:19 +00:00
|
|
|
|
2004-02-27 15:43:58 +00:00
|
|
|
#include "config/gimpcoreconfig.h"
|
|
|
|
|
|
|
|
#include "file/file-utils.h"
|
|
|
|
|
2004-02-27 14:20:19 +00:00
|
|
|
#include "plug-in/plug-in-proc.h"
|
2004-07-16 21:24:39 +00:00
|
|
|
#include "plug-in/plug-ins.h"
|
2004-02-27 14:20:19 +00:00
|
|
|
|
|
|
|
#include "gimpfiledialog.h"
|
2004-07-16 21:24:39 +00:00
|
|
|
#include "gimpfileprocview.h"
|
2004-07-17 19:53:05 +00:00
|
|
|
#include "gimphelp-ids.h"
|
2004-08-24 17:16:46 +00:00
|
|
|
#include "gimpview.h"
|
2004-07-17 19:53:05 +00:00
|
|
|
#include "gimppreviewrendererimagefile.h"
|
|
|
|
#include "gimpthumbbox.h"
|
2004-08-10 22:21:56 +00:00
|
|
|
#include "gimpwidgets-utils.h"
|
2004-04-15 16:28:26 +00:00
|
|
|
|
2004-02-27 14:20:19 +00:00
|
|
|
#include "gimp-intl.h"
|
|
|
|
|
|
|
|
|
2004-08-10 18:47:21 +00:00
|
|
|
static void gimp_file_dialog_class_init (GimpFileDialogClass *klass);
|
|
|
|
static void gimp_file_dialog_progress_iface_init (GimpProgressInterface *progress_iface);
|
2004-02-27 14:20:19 +00:00
|
|
|
|
2004-08-11 10:29:56 +00:00
|
|
|
static gboolean gimp_file_dialog_delete_event (GtkWidget *widget,
|
|
|
|
GdkEventAny *event);
|
|
|
|
static void gimp_file_dialog_response (GtkDialog *dialog,
|
|
|
|
gint response_id);
|
2004-02-27 14:20:19 +00:00
|
|
|
|
2004-08-10 18:47:21 +00:00
|
|
|
static GimpProgress *
|
2004-08-11 10:29:56 +00:00
|
|
|
gimp_file_dialog_progress_start (GimpProgress *progress,
|
|
|
|
const gchar *message,
|
|
|
|
gboolean cancelable);
|
|
|
|
static void gimp_file_dialog_progress_end (GimpProgress *progress);
|
|
|
|
static gboolean gimp_file_dialog_progress_is_active (GimpProgress *progress);
|
|
|
|
static void gimp_file_dialog_progress_set_text (GimpProgress *progress,
|
|
|
|
const gchar *message);
|
|
|
|
static void gimp_file_dialog_progress_set_value (GimpProgress *progress,
|
|
|
|
gdouble percentage);
|
|
|
|
static gdouble gimp_file_dialog_progress_get_value (GimpProgress *progress);
|
|
|
|
|
|
|
|
static void gimp_file_dialog_add_preview (GimpFileDialog *dialog,
|
|
|
|
Gimp *gimp);
|
|
|
|
static void gimp_file_dialog_add_filters (GimpFileDialog *dialog,
|
|
|
|
Gimp *gimp,
|
|
|
|
GSList *file_procs);
|
|
|
|
static void gimp_file_dialog_add_proc_selection (GimpFileDialog *dialog,
|
|
|
|
Gimp *gimp,
|
|
|
|
GSList *file_procs,
|
|
|
|
const gchar *automatic,
|
|
|
|
const gchar *automatic_help_id);
|
|
|
|
|
|
|
|
static void gimp_file_dialog_selection_changed (GtkFileChooser *chooser,
|
|
|
|
GimpFileDialog *dialog);
|
|
|
|
static void gimp_file_dialog_update_preview (GtkFileChooser *chooser,
|
|
|
|
GimpFileDialog *dialog);
|
|
|
|
|
|
|
|
static void gimp_file_dialog_proc_changed (GimpFileProcView *view,
|
|
|
|
GimpFileDialog *dialog);
|
|
|
|
|
|
|
|
static void gimp_file_dialog_help_func (const gchar *help_id,
|
|
|
|
gpointer help_data);
|
2004-07-17 19:53:05 +00:00
|
|
|
|
2004-02-27 14:20:19 +00:00
|
|
|
|
|
|
|
|
|
|
|
GType
|
|
|
|
gimp_file_dialog_get_type (void)
|
|
|
|
{
|
|
|
|
static GType dialog_type = 0;
|
|
|
|
|
|
|
|
if (! dialog_type)
|
|
|
|
{
|
|
|
|
static const GTypeInfo dialog_info =
|
|
|
|
{
|
|
|
|
sizeof (GimpFileDialogClass),
|
|
|
|
(GBaseInitFunc) NULL,
|
|
|
|
(GBaseFinalizeFunc) NULL,
|
|
|
|
(GClassInitFunc) gimp_file_dialog_class_init,
|
|
|
|
NULL, /* class_finalize */
|
|
|
|
NULL, /* class_data */
|
|
|
|
sizeof (GimpFileDialog),
|
|
|
|
0, /* n_preallocs */
|
2004-07-16 21:24:39 +00:00
|
|
|
NULL, /* instance_init */
|
2004-02-27 14:20:19 +00:00
|
|
|
};
|
|
|
|
|
2004-08-10 18:47:21 +00:00
|
|
|
static const GInterfaceInfo progress_iface_info =
|
|
|
|
{
|
|
|
|
(GInterfaceInitFunc) gimp_file_dialog_progress_iface_init,
|
|
|
|
NULL, /* iface_finalize */
|
|
|
|
NULL /* iface_data */
|
|
|
|
};
|
|
|
|
|
2004-04-15 16:28:26 +00:00
|
|
|
dialog_type = g_type_register_static (GTK_TYPE_FILE_CHOOSER_DIALOG,
|
2004-02-27 14:20:19 +00:00
|
|
|
"GimpFileDialog",
|
|
|
|
&dialog_info, 0);
|
2004-08-10 18:47:21 +00:00
|
|
|
|
|
|
|
g_type_add_interface_static (dialog_type, GIMP_TYPE_PROGRESS,
|
|
|
|
&progress_iface_info);
|
2004-02-27 14:20:19 +00:00
|
|
|
}
|
|
|
|
|
|
|
|
return dialog_type;
|
|
|
|
}
|
|
|
|
|
|
|
|
static void
|
|
|
|
gimp_file_dialog_class_init (GimpFileDialogClass *klass)
|
|
|
|
{
|
|
|
|
GtkWidgetClass *widget_class = GTK_WIDGET_CLASS (klass);
|
2004-08-10 21:20:38 +00:00
|
|
|
GtkDialogClass *dialog_class = GTK_DIALOG_CLASS (klass);
|
2004-02-27 14:20:19 +00:00
|
|
|
|
|
|
|
widget_class->delete_event = gimp_file_dialog_delete_event;
|
2004-08-10 21:20:38 +00:00
|
|
|
|
|
|
|
dialog_class->response = gimp_file_dialog_response;
|
2004-02-27 14:20:19 +00:00
|
|
|
}
|
|
|
|
|
2004-08-10 18:47:21 +00:00
|
|
|
static void
|
|
|
|
gimp_file_dialog_progress_iface_init (GimpProgressInterface *progress_iface)
|
|
|
|
{
|
|
|
|
progress_iface->start = gimp_file_dialog_progress_start;
|
|
|
|
progress_iface->end = gimp_file_dialog_progress_end;
|
2004-08-11 10:29:56 +00:00
|
|
|
progress_iface->is_active = gimp_file_dialog_progress_is_active;
|
2004-08-10 18:47:21 +00:00
|
|
|
progress_iface->set_text = gimp_file_dialog_progress_set_text;
|
|
|
|
progress_iface->set_value = gimp_file_dialog_progress_set_value;
|
|
|
|
progress_iface->get_value = gimp_file_dialog_progress_get_value;
|
|
|
|
}
|
|
|
|
|
2004-02-27 14:20:19 +00:00
|
|
|
static gboolean
|
|
|
|
gimp_file_dialog_delete_event (GtkWidget *widget,
|
|
|
|
GdkEventAny *event)
|
|
|
|
{
|
|
|
|
return TRUE;
|
|
|
|
}
|
|
|
|
|
2004-08-10 21:20:38 +00:00
|
|
|
static void
|
|
|
|
gimp_file_dialog_response (GtkDialog *dialog,
|
|
|
|
gint response_id)
|
|
|
|
{
|
|
|
|
GimpFileDialog *file_dialog = GIMP_FILE_DIALOG (dialog);
|
|
|
|
|
|
|
|
if (response_id != GTK_RESPONSE_OK && file_dialog->busy)
|
|
|
|
{
|
|
|
|
file_dialog->canceled = TRUE;
|
|
|
|
|
|
|
|
if (file_dialog->progress_active && file_dialog->progress_cancelable)
|
|
|
|
gimp_progress_cancel (GIMP_PROGRESS (dialog));
|
|
|
|
}
|
|
|
|
}
|
|
|
|
|
2004-08-10 18:47:21 +00:00
|
|
|
static GimpProgress *
|
|
|
|
gimp_file_dialog_progress_start (GimpProgress *progress,
|
|
|
|
const gchar *message,
|
|
|
|
gboolean cancelable)
|
|
|
|
{
|
|
|
|
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
|
|
|
|
|
|
|
|
if (! dialog->progress_active)
|
|
|
|
{
|
|
|
|
GtkProgressBar *bar = GTK_PROGRESS_BAR (dialog->progress);
|
|
|
|
|
|
|
|
gtk_progress_bar_set_text (bar, message);
|
|
|
|
gtk_progress_bar_set_fraction (bar, 0.0);
|
|
|
|
|
|
|
|
gtk_widget_show (dialog->progress);
|
|
|
|
|
2004-08-10 21:20:38 +00:00
|
|
|
dialog->progress_active = TRUE;
|
|
|
|
dialog->progress_cancelable = cancelable;
|
2004-08-10 18:47:21 +00:00
|
|
|
|
|
|
|
return progress;
|
|
|
|
}
|
|
|
|
|
|
|
|
return NULL;
|
|
|
|
}
|
|
|
|
|
|
|
|
static void
|
|
|
|
gimp_file_dialog_progress_end (GimpProgress *progress)
|
|
|
|
{
|
|
|
|
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
|
|
|
|
|
|
|
|
if (dialog->progress_active)
|
|
|
|
{
|
|
|
|
GtkProgressBar *bar = GTK_PROGRESS_BAR (dialog->progress);
|
|
|
|
|
|
|
|
gtk_progress_bar_set_text (bar, "");
|
|
|
|
gtk_progress_bar_set_fraction (bar, 0.0);
|
|
|
|
|
|
|
|
gtk_widget_hide (dialog->progress);
|
|
|
|
|
2004-08-10 21:20:38 +00:00
|
|
|
dialog->progress_active = FALSE;
|
|
|
|
dialog->progress_cancelable = FALSE;
|
2004-08-10 18:47:21 +00:00
|
|
|
}
|
|
|
|
}
|
|
|
|
|
2004-08-11 10:29:56 +00:00
|
|
|
static gboolean
|
|
|
|
gimp_file_dialog_progress_is_active (GimpProgress *progress)
|
|
|
|
{
|
|
|
|
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
|
|
|
|
|
|
|
|
return dialog->progress_active;
|
|
|
|
}
|
|
|
|
|
2004-08-10 18:47:21 +00:00
|
|
|
static void
|
|
|
|
gimp_file_dialog_progress_set_text (GimpProgress *progress,
|
|
|
|
const gchar *message)
|
|
|
|
{
|
|
|
|
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
|
|
|
|
|
|
|
|
if (dialog->progress_active)
|
|
|
|
{
|
|
|
|
GtkProgressBar *bar = GTK_PROGRESS_BAR (dialog->progress);
|
|
|
|
|
|
|
|
gtk_progress_bar_set_text (bar, message);
|
|
|
|
}
|
|
|
|
}
|
|
|
|
|
|
|
|
static void
|
|
|
|
gimp_file_dialog_progress_set_value (GimpProgress *progress,
|
|
|
|
gdouble percentage)
|
|
|
|
{
|
|
|
|
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
|
|
|
|
|
|
|
|
if (dialog->progress_active)
|
|
|
|
{
|
|
|
|
GtkProgressBar *bar = GTK_PROGRESS_BAR (dialog->progress);
|
|
|
|
|
|
|
|
gtk_progress_bar_set_fraction (bar, percentage);
|
|
|
|
}
|
|
|
|
}
|
|
|
|
|
|
|
|
static gdouble
|
|
|
|
gimp_file_dialog_progress_get_value (GimpProgress *progress)
|
|
|
|
{
|
|
|
|
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
|
|
|
|
|
|
|
|
if (dialog->progress_active)
|
|
|
|
{
|
|
|
|
GtkProgressBar *bar = GTK_PROGRESS_BAR (dialog->progress);
|
|
|
|
|
|
|
|
return gtk_progress_bar_get_fraction (bar);
|
|
|
|
}
|
|
|
|
|
|
|
|
return 0.0;
|
|
|
|
}
|
|
|
|
|
2004-02-27 14:20:19 +00:00
|
|
|
|
|
|
|
/* public functions */
|
|
|
|
|
|
|
|
GtkWidget *
|
2004-04-15 16:28:26 +00:00
|
|
|
gimp_file_dialog_new (Gimp *gimp,
|
|
|
|
GtkFileChooserAction action,
|
|
|
|
const gchar *title,
|
|
|
|
const gchar *role,
|
|
|
|
const gchar *stock_id,
|
|
|
|
const gchar *help_id)
|
2004-02-27 14:20:19 +00:00
|
|
|
{
|
|
|
|
GimpFileDialog *dialog;
|
2004-07-16 21:24:39 +00:00
|
|
|
GSList *file_procs;
|
|
|
|
const gchar *automatic;
|
2004-07-17 19:53:05 +00:00
|
|
|
const gchar *automatic_help_id;
|
2004-02-27 14:20:19 +00:00
|
|
|
|
|
|
|
g_return_val_if_fail (GIMP_IS_GIMP (gimp), NULL);
|
|
|
|
g_return_val_if_fail (title != NULL, NULL);
|
|
|
|
g_return_val_if_fail (role != NULL, NULL);
|
|
|
|
g_return_val_if_fail (stock_id != NULL, NULL);
|
|
|
|
g_return_val_if_fail (help_id != NULL, NULL);
|
|
|
|
|
2004-07-16 21:24:39 +00:00
|
|
|
switch (action)
|
|
|
|
{
|
|
|
|
case GTK_FILE_CHOOSER_ACTION_OPEN:
|
|
|
|
file_procs = gimp->load_procs;
|
2004-07-27 12:41:44 +00:00
|
|
|
automatic = _("Automatically Detected");
|
2004-07-17 19:53:05 +00:00
|
|
|
automatic_help_id = GIMP_HELP_FILE_OPEN_BY_EXTENSION;
|
2004-07-16 21:24:39 +00:00
|
|
|
break;
|
|
|
|
|
|
|
|
case GTK_FILE_CHOOSER_ACTION_SAVE:
|
|
|
|
file_procs = gimp->save_procs;
|
|
|
|
automatic = _("By Extension");
|
2004-07-17 19:53:05 +00:00
|
|
|
automatic_help_id = GIMP_HELP_FILE_SAVE_BY_EXTENSION;
|
2004-07-16 21:24:39 +00:00
|
|
|
break;
|
|
|
|
|
|
|
|
default:
|
|
|
|
g_return_val_if_reached (NULL);
|
|
|
|
return NULL;
|
|
|
|
}
|
|
|
|
|
2004-02-27 14:20:19 +00:00
|
|
|
dialog = g_object_new (GIMP_TYPE_FILE_DIALOG,
|
2004-04-15 16:28:26 +00:00
|
|
|
"title", title,
|
|
|
|
"role", role,
|
|
|
|
"action", action,
|
2004-02-27 14:20:19 +00:00
|
|
|
NULL);
|
|
|
|
|
2004-04-15 16:28:26 +00:00
|
|
|
gtk_dialog_add_buttons (GTK_DIALOG (dialog),
|
|
|
|
GTK_STOCK_CANCEL, GTK_RESPONSE_CANCEL,
|
|
|
|
stock_id, GTK_RESPONSE_OK,
|
|
|
|
NULL);
|
|
|
|
|
|
|
|
gtk_dialog_set_default_response (GTK_DIALOG (dialog), GTK_RESPONSE_OK);
|
2004-02-27 14:20:19 +00:00
|
|
|
|
2004-07-16 21:24:39 +00:00
|
|
|
gimp_help_connect (GTK_WIDGET (dialog),
|
2004-07-17 19:53:05 +00:00
|
|
|
gimp_file_dialog_help_func, help_id, dialog);
|
2004-02-27 14:20:19 +00:00
|
|
|
|
2004-07-16 21:24:39 +00:00
|
|
|
gimp_file_dialog_add_preview (dialog, gimp);
|
2004-02-27 14:20:19 +00:00
|
|
|
|
2004-07-16 21:24:39 +00:00
|
|
|
gimp_file_dialog_add_filters (dialog, gimp, file_procs);
|
2004-02-27 14:20:19 +00:00
|
|
|
|
2004-08-10 21:20:38 +00:00
|
|
|
gimp_file_dialog_add_proc_selection (dialog, gimp, file_procs, automatic,
|
|
|
|
automatic_help_id);
|
2004-08-10 18:47:21 +00:00
|
|
|
|
|
|
|
dialog->progress = gtk_progress_bar_new ();
|
2004-08-10 21:20:38 +00:00
|
|
|
gtk_box_pack_end (GTK_BOX (GTK_DIALOG (dialog)->vbox), dialog->progress,
|
|
|
|
FALSE, FALSE, 0);
|
2004-02-27 15:43:58 +00:00
|
|
|
|
2004-02-27 14:20:19 +00:00
|
|
|
return GTK_WIDGET (dialog);
|
|
|
|
}
|
|
|
|
|
2004-08-10 21:20:38 +00:00
|
|
|
void
|
|
|
|
gimp_file_dialog_set_sensitive (GimpFileDialog *dialog,
|
|
|
|
gboolean sensitive)
|
|
|
|
{
|
|
|
|
g_return_if_fail (GIMP_IS_FILE_DIALOG (dialog));
|
|
|
|
|
2004-08-10 22:21:56 +00:00
|
|
|
gimp_dialog_set_sensitive (GTK_DIALOG (dialog), sensitive);
|
2004-08-10 21:20:38 +00:00
|
|
|
|
|
|
|
dialog->busy = ! sensitive;
|
|
|
|
dialog->canceled = FALSE;
|
|
|
|
}
|
|
|
|
|
2004-02-27 14:20:19 +00:00
|
|
|
void
|
|
|
|
gimp_file_dialog_set_file_proc (GimpFileDialog *dialog,
|
|
|
|
PlugInProcDef *file_proc)
|
|
|
|
{
|
|
|
|
g_return_if_fail (GIMP_IS_FILE_DIALOG (dialog));
|
|
|
|
|
2004-07-16 21:24:39 +00:00
|
|
|
if (file_proc != dialog->file_proc)
|
|
|
|
gimp_file_proc_view_set_proc (GIMP_FILE_PROC_VIEW (dialog->proc_view),
|
|
|
|
file_proc);
|
2004-02-27 14:20:19 +00:00
|
|
|
}
|
2004-02-27 15:43:58 +00:00
|
|
|
|
2004-03-01 13:40:46 +00:00
|
|
|
void
|
|
|
|
gimp_file_dialog_set_uri (GimpFileDialog *dialog,
|
|
|
|
GimpImage *gimage,
|
|
|
|
const gchar *uri)
|
|
|
|
{
|
2004-04-15 16:28:26 +00:00
|
|
|
gchar *real_uri = NULL;
|
|
|
|
gboolean is_folder = FALSE;
|
2004-03-01 13:40:46 +00:00
|
|
|
|
|
|
|
g_return_if_fail (GIMP_IS_FILE_DIALOG (dialog));
|
|
|
|
g_return_if_fail (gimage == NULL || GIMP_IS_IMAGE (gimage));
|
|
|
|
|
|
|
|
if (gimage)
|
|
|
|
{
|
2004-04-15 16:28:26 +00:00
|
|
|
gchar *filename = gimp_image_get_filename (gimage);
|
2004-03-01 13:40:46 +00:00
|
|
|
|
|
|
|
if (filename)
|
|
|
|
{
|
2004-04-15 16:28:26 +00:00
|
|
|
gchar *dirname = g_path_get_dirname (filename);
|
2004-03-01 13:40:46 +00:00
|
|
|
|
|
|
|
g_free (filename);
|
|
|
|
|
2004-04-15 16:28:26 +00:00
|
|
|
real_uri = g_filename_to_uri (dirname, NULL, NULL);
|
2004-03-01 13:40:46 +00:00
|
|
|
g_free (dirname);
|
2004-04-15 16:28:26 +00:00
|
|
|
|
|
|
|
is_folder = TRUE;
|
2004-03-01 13:40:46 +00:00
|
|
|
}
|
|
|
|
}
|
|
|
|
else if (uri)
|
|
|
|
{
|
2004-04-15 16:28:26 +00:00
|
|
|
real_uri = g_strdup (uri);
|
2004-03-01 13:40:46 +00:00
|
|
|
}
|
2004-07-27 12:39:56 +00:00
|
|
|
|
|
|
|
if (! real_uri)
|
2004-04-15 16:28:26 +00:00
|
|
|
{
|
|
|
|
gchar *current = g_get_current_dir ();
|
|
|
|
|
|
|
|
real_uri = g_filename_to_uri (current, NULL, NULL);
|
|
|
|
g_free (current);
|
2004-03-01 13:40:46 +00:00
|
|
|
|
2004-04-15 16:28:26 +00:00
|
|
|
is_folder = TRUE;
|
|
|
|
}
|
2004-03-01 13:40:46 +00:00
|
|
|
|
2004-04-15 16:28:26 +00:00
|
|
|
if (is_folder)
|
|
|
|
gtk_file_chooser_set_current_folder_uri (GTK_FILE_CHOOSER (dialog),
|
|
|
|
real_uri);
|
|
|
|
else
|
|
|
|
gtk_file_chooser_set_uri (GTK_FILE_CHOOSER (dialog), real_uri);
|
|
|
|
|
|
|
|
g_free (real_uri);
|
2004-03-01 13:40:46 +00:00
|
|
|
}
|
|
|
|
|
2004-03-01 12:27:33 +00:00
|
|
|
void
|
|
|
|
gimp_file_dialog_set_image (GimpFileDialog *dialog,
|
|
|
|
GimpImage *gimage,
|
|
|
|
gboolean set_uri_and_proc,
|
|
|
|
gboolean set_image_clean)
|
|
|
|
{
|
2004-04-15 16:28:26 +00:00
|
|
|
const gchar *uri;
|
2004-08-23 09:32:06 +00:00
|
|
|
gboolean uri_set = FALSE;
|
2004-03-01 12:27:33 +00:00
|
|
|
|
|
|
|
g_return_if_fail (GIMP_IS_FILE_DIALOG (dialog));
|
|
|
|
g_return_if_fail (GIMP_IS_IMAGE (gimage));
|
|
|
|
|
|
|
|
dialog->gimage = gimage;
|
|
|
|
dialog->set_uri_and_proc = set_uri_and_proc;
|
|
|
|
dialog->set_image_clean = set_image_clean;
|
|
|
|
|
2004-04-15 16:28:26 +00:00
|
|
|
uri = gimp_object_get_name (GIMP_OBJECT (gimage));
|
2004-03-01 12:27:33 +00:00
|
|
|
|
2004-04-15 16:28:26 +00:00
|
|
|
if (uri)
|
2004-08-23 09:32:06 +00:00
|
|
|
uri_set = gtk_file_chooser_set_uri (GTK_FILE_CHOOSER (dialog), uri);
|
|
|
|
|
|
|
|
if (! uri_set)
|
2004-06-22 15:11:35 +00:00
|
|
|
gtk_file_chooser_set_current_name (GTK_FILE_CHOOSER (dialog), "");
|
2004-03-01 12:27:33 +00:00
|
|
|
|
2004-07-16 21:24:39 +00:00
|
|
|
gimp_file_dialog_set_file_proc (dialog, NULL);
|
2004-03-01 12:27:33 +00:00
|
|
|
}
|
|
|
|
|
2004-02-27 15:43:58 +00:00
|
|
|
|
|
|
|
/* private functions */
|
|
|
|
|
2004-07-16 21:24:39 +00:00
|
|
|
static void
|
|
|
|
gimp_file_dialog_add_preview (GimpFileDialog *dialog,
|
|
|
|
Gimp *gimp)
|
|
|
|
{
|
|
|
|
if (gimp->config->thumbnail_size <= 0)
|
|
|
|
return;
|
|
|
|
|
|
|
|
gtk_file_chooser_set_use_preview_label (GTK_FILE_CHOOSER (dialog), FALSE);
|
|
|
|
|
|
|
|
g_signal_connect (dialog, "selection-changed",
|
|
|
|
G_CALLBACK (gimp_file_dialog_selection_changed),
|
|
|
|
dialog);
|
|
|
|
g_signal_connect (dialog, "update-preview",
|
|
|
|
G_CALLBACK (gimp_file_dialog_update_preview),
|
|
|
|
dialog);
|
|
|
|
|
|
|
|
dialog->thumb_box = gimp_thumb_box_new (gimp);
|
|
|
|
gtk_widget_set_sensitive (GTK_WIDGET (dialog->thumb_box), FALSE);
|
|
|
|
gtk_file_chooser_set_preview_widget (GTK_FILE_CHOOSER (dialog),
|
|
|
|
dialog->thumb_box);
|
|
|
|
gtk_widget_show (dialog->thumb_box);
|
|
|
|
|
|
|
|
#ifdef ENABLE_FILE_SYSTEM_ICONS
|
2004-08-24 17:16:46 +00:00
|
|
|
GIMP_PREVIEW_RENDERER_IMAGEFILE (GIMP_VIEW (GIMP_THUMB_BOX (dialog->thumb_box)->preview)->renderer)->file_system = _gtk_file_chooser_get_file_system (GTK_FILE_CHOOSER (dialog));
|
2004-07-16 21:24:39 +00:00
|
|
|
#endif
|
|
|
|
}
|
|
|
|
|
|
|
|
static void
|
|
|
|
gimp_file_dialog_add_filters (GimpFileDialog *dialog,
|
|
|
|
Gimp *gimp,
|
|
|
|
GSList *file_procs)
|
|
|
|
{
|
|
|
|
GtkFileFilter *filter;
|
|
|
|
GSList *list;
|
|
|
|
|
|
|
|
filter = gtk_file_filter_new ();
|
2004-07-27 00:26:14 +00:00
|
|
|
gtk_file_filter_set_name (filter, _("All Files (*.*)"));
|
2004-07-16 21:24:39 +00:00
|
|
|
gtk_file_filter_add_pattern (filter, "*");
|
|
|
|
gtk_file_chooser_add_filter (GTK_FILE_CHOOSER (dialog), filter);
|
|
|
|
gtk_file_chooser_set_filter (GTK_FILE_CHOOSER (dialog), filter);
|
|
|
|
|
|
|
|
for (list = file_procs; list; list = g_slist_next (list))
|
|
|
|
{
|
|
|
|
PlugInProcDef *file_proc = list->data;
|
|
|
|
|
|
|
|
if (file_proc->menu_paths && file_proc->extensions_list)
|
|
|
|
{
|
|
|
|
const gchar *domain;
|
2004-07-27 00:26:14 +00:00
|
|
|
GString *label;
|
2004-07-16 21:24:39 +00:00
|
|
|
GSList *ext;
|
2004-07-27 00:26:14 +00:00
|
|
|
gboolean first = TRUE;
|
2004-07-16 21:24:39 +00:00
|
|
|
|
|
|
|
domain = plug_ins_locale_domain (gimp, file_proc->prog, NULL);
|
2004-07-27 00:26:14 +00:00
|
|
|
|
|
|
|
label = g_string_new (plug_in_proc_def_get_label (file_proc, domain));
|
2004-07-16 21:24:39 +00:00
|
|
|
|
|
|
|
filter = gtk_file_filter_new ();
|
|
|
|
|
2004-07-27 00:26:14 +00:00
|
|
|
for (ext = file_proc->extensions_list; ext; ext = g_slist_next (ext))
|
2004-07-16 21:24:39 +00:00
|
|
|
{
|
2004-07-27 00:26:14 +00:00
|
|
|
const gchar *extension = ext->data;
|
|
|
|
gchar *pattern = g_strdup_printf ("*.%s", extension);
|
2004-07-16 21:24:39 +00:00
|
|
|
|
|
|
|
gtk_file_filter_add_pattern (filter, pattern);
|
|
|
|
g_free (pattern);
|
2004-07-27 00:26:14 +00:00
|
|
|
|
|
|
|
if (first)
|
|
|
|
{
|
|
|
|
g_string_append (label, " (*.");
|
|
|
|
first = FALSE;
|
|
|
|
}
|
|
|
|
|
|
|
|
g_string_append (label, extension);
|
|
|
|
g_string_append (label, ext->next ? ", *." : ")");
|
2004-07-16 21:24:39 +00:00
|
|
|
}
|
|
|
|
|
2004-07-27 00:26:14 +00:00
|
|
|
gtk_file_filter_set_name (filter, label->str);
|
|
|
|
g_string_free (label, TRUE);
|
|
|
|
|
2004-07-16 21:24:39 +00:00
|
|
|
gtk_file_chooser_add_filter (GTK_FILE_CHOOSER (dialog), filter);
|
|
|
|
}
|
|
|
|
}
|
|
|
|
}
|
|
|
|
|
|
|
|
static void
|
|
|
|
gimp_file_dialog_add_proc_selection (GimpFileDialog *dialog,
|
|
|
|
Gimp *gimp,
|
|
|
|
GSList *file_procs,
|
2004-07-17 19:53:05 +00:00
|
|
|
const gchar *automatic,
|
2004-08-10 21:20:38 +00:00
|
|
|
const gchar *automatic_help_id)
|
2004-07-16 21:24:39 +00:00
|
|
|
{
|
2004-07-17 13:06:59 +00:00
|
|
|
GtkWidget *scrolled_window;
|
2004-07-16 21:24:39 +00:00
|
|
|
|
|
|
|
dialog->proc_expander = gtk_expander_new_with_mnemonic (NULL);
|
2004-08-10 21:20:38 +00:00
|
|
|
gtk_file_chooser_set_extra_widget (GTK_FILE_CHOOSER (dialog),
|
|
|
|
dialog->proc_expander);
|
2004-07-16 21:24:39 +00:00
|
|
|
gtk_widget_show (dialog->proc_expander);
|
|
|
|
|
2004-07-17 13:06:59 +00:00
|
|
|
scrolled_window = gtk_scrolled_window_new (NULL, NULL);
|
|
|
|
gtk_scrolled_window_set_policy (GTK_SCROLLED_WINDOW (scrolled_window),
|
2004-07-16 21:24:39 +00:00
|
|
|
GTK_POLICY_AUTOMATIC, GTK_POLICY_AUTOMATIC);
|
2004-07-17 13:06:59 +00:00
|
|
|
gtk_scrolled_window_set_shadow_type (GTK_SCROLLED_WINDOW (scrolled_window),
|
|
|
|
GTK_SHADOW_IN);
|
|
|
|
gtk_container_add (GTK_CONTAINER (dialog->proc_expander), scrolled_window);
|
|
|
|
gtk_widget_show (scrolled_window);
|
2004-07-16 21:24:39 +00:00
|
|
|
|
2004-07-17 13:06:59 +00:00
|
|
|
gtk_widget_set_size_request (scrolled_window, -1, 200);
|
2004-07-16 21:24:39 +00:00
|
|
|
|
2004-07-17 19:53:05 +00:00
|
|
|
dialog->proc_view = gimp_file_proc_view_new (gimp, file_procs, automatic,
|
|
|
|
automatic_help_id);
|
2004-07-17 13:06:59 +00:00
|
|
|
gtk_container_add (GTK_CONTAINER (scrolled_window), dialog->proc_view);
|
2004-07-16 21:24:39 +00:00
|
|
|
gtk_widget_show (dialog->proc_view);
|
|
|
|
|
|
|
|
g_signal_connect (dialog->proc_view, "changed",
|
|
|
|
G_CALLBACK (gimp_file_dialog_proc_changed),
|
|
|
|
dialog);
|
|
|
|
|
|
|
|
gimp_file_proc_view_set_proc (GIMP_FILE_PROC_VIEW (dialog->proc_view), NULL);
|
|
|
|
}
|
|
|
|
|
2004-02-27 15:43:58 +00:00
|
|
|
static void
|
2004-04-15 16:28:26 +00:00
|
|
|
gimp_file_dialog_selection_changed (GtkFileChooser *chooser,
|
|
|
|
GimpFileDialog *dialog)
|
2004-02-27 15:43:58 +00:00
|
|
|
{
|
2004-06-22 15:11:35 +00:00
|
|
|
gimp_thumb_box_take_uris (GIMP_THUMB_BOX (dialog->thumb_box),
|
|
|
|
gtk_file_chooser_get_uris (chooser));
|
2004-04-15 16:28:26 +00:00
|
|
|
}
|
2004-02-27 15:43:58 +00:00
|
|
|
|
2004-04-15 16:28:26 +00:00
|
|
|
static void
|
|
|
|
gimp_file_dialog_update_preview (GtkFileChooser *chooser,
|
|
|
|
GimpFileDialog *dialog)
|
|
|
|
{
|
|
|
|
gchar *uri = gtk_file_chooser_get_preview_uri (chooser);
|
2004-02-27 15:43:58 +00:00
|
|
|
|
2004-04-15 16:28:26 +00:00
|
|
|
gimp_thumb_box_set_uri (GIMP_THUMB_BOX (dialog->thumb_box), uri);
|
2004-02-27 15:43:58 +00:00
|
|
|
|
2004-04-15 16:28:26 +00:00
|
|
|
g_free (uri);
|
2004-02-27 15:43:58 +00:00
|
|
|
}
|
2004-07-16 21:24:39 +00:00
|
|
|
|
|
|
|
static void
|
|
|
|
gimp_file_dialog_proc_changed (GimpFileProcView *view,
|
|
|
|
GimpFileDialog *dialog)
|
|
|
|
{
|
|
|
|
GtkFileChooser *chooser = GTK_FILE_CHOOSER (dialog);
|
|
|
|
gchar *name;
|
|
|
|
gchar *label;
|
|
|
|
|
|
|
|
dialog->file_proc = gimp_file_proc_view_get_proc (view, &name);
|
|
|
|
|
|
|
|
label = g_strdup_printf (_("Select File _Type (%s)"), name);
|
|
|
|
|
|
|
|
gtk_expander_set_label (GTK_EXPANDER (dialog->proc_expander), label);
|
|
|
|
|
|
|
|
g_free (label);
|
|
|
|
g_free (name);
|
|
|
|
|
|
|
|
if (gtk_file_chooser_get_action (chooser) == GTK_FILE_CHOOSER_ACTION_SAVE)
|
|
|
|
{
|
|
|
|
PlugInProcDef *proc = dialog->file_proc;
|
|
|
|
|
|
|
|
if (proc && proc->extensions_list)
|
|
|
|
{
|
|
|
|
gchar *uri = gtk_file_chooser_get_uri (chooser);
|
|
|
|
|
|
|
|
if (uri && strlen (uri))
|
|
|
|
{
|
|
|
|
const gchar *last_dot = strrchr (uri, '.');
|
|
|
|
|
|
|
|
if (last_dot != uri)
|
|
|
|
{
|
|
|
|
GString *s = g_string_new (uri);
|
|
|
|
gchar *basename;
|
|
|
|
|
|
|
|
if (last_dot)
|
|
|
|
g_string_truncate (s, last_dot - uri);
|
|
|
|
|
|
|
|
g_string_append (s, ".");
|
|
|
|
g_string_append (s, (gchar *) proc->extensions_list->data);
|
|
|
|
|
|
|
|
gtk_file_chooser_set_uri (chooser, s->str);
|
|
|
|
|
|
|
|
basename = file_utils_uri_to_utf8_basename (s->str);
|
|
|
|
gtk_file_chooser_set_current_name (chooser, basename);
|
|
|
|
g_free (basename);
|
|
|
|
|
|
|
|
g_string_free (s, TRUE);
|
|
|
|
}
|
|
|
|
}
|
|
|
|
|
|
|
|
g_free (uri);
|
|
|
|
}
|
|
|
|
}
|
|
|
|
}
|
2004-07-17 19:53:05 +00:00
|
|
|
|
|
|
|
static void
|
|
|
|
gimp_file_dialog_help_func (const gchar *help_id,
|
|
|
|
gpointer help_data)
|
|
|
|
{
|
|
|
|
GimpFileDialog *dialog = GIMP_FILE_DIALOG (help_data);
|
|
|
|
GtkWidget *focus;
|
|
|
|
|
|
|
|
focus = gtk_window_get_focus (GTK_WINDOW (dialog));
|
|
|
|
|
|
|
|
if (focus == dialog->proc_view)
|
|
|
|
{
|
|
|
|
gchar *proc_help_id;
|
|
|
|
|
|
|
|
proc_help_id =
|
|
|
|
gimp_file_proc_view_get_help_id (GIMP_FILE_PROC_VIEW (dialog->proc_view));
|
|
|
|
|
|
|
|
gimp_standard_help_func (proc_help_id, NULL);
|
|
|
|
|
|
|
|
g_free (proc_help_id);
|
|
|
|
}
|
|
|
|
else
|
|
|
|
{
|
|
|
|
gimp_standard_help_func (help_id, NULL);
|
|
|
|
}
|
|
|
|
}
|